Identifiers and Description

Gene Model Identifier

SteCoe_43

Standard Name

None

Aliases

None

Description

NOG1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig10756.0.g1110Nucleolar GTP-binding protein
1 (NOG1)

Saccharomyces CerevisiaeYPL093W8.854771883513433e-70Putative GTPase; associates wi
th free 60S ribosomal subunits
in the nucleolus and is requi
red for 60S ribosomal subunit
biogenesis; constituent of 66S
pre-ribosomal particles; memb
er of the ODN family of nucleo
lar G-proteins
WormBaseWBGene000202973.5722699376192174e-67

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_43(Protein)
MNYNFKSLPAVPTAKELIDIVLSKTQRKTPTEIHPQMQISRIRKFYMRKVKFTQSTIEEK
LGGMLEKFPKLDDIHPFYADLMNVLYDKDHYKLALGHVNKANHMVENVAKDYVRMLKYAD
SLYRGKTLKKAALGRMCTILKKLTNSLTYLEEVRKHLSRLPNIDPNSRSLIITGYPNVGK
SSFMNLVTRANVEVQPYAFTTKSLFVGHTDYDFIPWQVIDTPGLLDRPLEQRNTVEMQGI
TALAHLNSCILFFIDISETCTYKIPEQIQLFRSIQPLFVNKPIGIVLTKTDIKKWEEVDL
EHRNEIESLAAEHKAFIAQVSNENQDGVMNCRNLACEQLKAFRSQFKSKHTTATYTRAQP
YVAMPKNQIEDRPVNIPESVLTQMQSGEKSPFSQNIKEMQEMNGGAGVFYIPPQEHFVDL
EDEDWRYDVMPEFFEGKNVMDYIDPDIMDKLNDLEKEEEVLDDAHVPLDYDEMREIYEIR
RKIFLRRKRIQQESMIRKGTFKPKRKEWSDVREGLEQLGIDPTPLKDKIKEKRKREESPE
FTSNVDMDIDGDTGVETIKKRFRTKSKSLVKARKPGTIKDNPDRETLKHMAKVADKKHFD
TKPKHLNTGKSGIGKRDYR


>SteCoe_43(CDS)
ATGAACTACAACTTTAAGTCCTTGCCAGCAGTGCCAACTGCTAAAGAGCTTATCGACATA
GTTCTATCCAAAACCCAGAGAAAAACGCCAACCGAAATCCACCCTCAAATGCAAATCAGT
CGCATTCGTAAGTTTTACATGCGTAAGGTCAAGTTCACCCAATCAACAATCGAAGAAAAG
CTTGGTGGTATGTTGGAAAAGTTCCCTAAACTTGATGATATCCACCCATTCTATGCTGAT
CTCATGAACGTTTTATATGATAAAGACCACTATAAACTAGCTCTAGGCCATGTAAACAAG
GCCAACCACATGGTAGAAAATGTGGCTAAAGACTATGTTCGTATGTTAAAATATGCTGAT
AGTCTTTATAGAGGTAAAACTTTGAAAAAAGCAGCACTTGGACGTATGTGCACGATCTTA
AAAAAACTAACCAATTCACTCACTTACCTTGAAGAGGTTCGTAAGCATTTGTCTAGGCTT
CCAAATATCGATCCAAATAGCAGAAGTTTGATTATAACTGGATATCCTAATGTTGGTAAA
AGTTCATTTATGAATCTTGTAACCAGAGCTAACGTTGAAGTCCAACCCTATGCTTTTACA
ACCAAAAGTCTATTTGTTGGACATACTGACTATGATTTCATCCCTTGGCAAGTTATTGAC
ACCCCTGGATTACTTGATCGTCCTTTAGAACAGAGAAATACTGTTGAAATGCAAGGTATC
ACAGCTTTAGCCCATCTCAACTCATGTATCTTATTTTTCATCGATATTTCTGAAACATGC
ACTTATAAAATCCCTGAACAAATTCAATTATTTAGAAGTATTCAACCTCTTTTTGTCAAT
AAACCTATAGGGATTGTCTTAACTAAAACTGATATAAAAAAATGGGAAGAAGTAGACTTA
GAGCATAGAAATGAAATCGAAAGCTTAGCTGCTGAACATAAAGCATTTATTGCCCAGGTT
TCTAATGAAAACCAAGATGGGGTTATGAACTGTAGGAACTTGGCTTGTGAACAATTAAAA
GCTTTTCGTAGCCAATTCAAAAGTAAACATACTACTGCAACTTATACAAGGGCTCAACCT
TATGTGGCAATGCCTAAAAACCAAATAGAAGATCGTCCTGTGAATATTCCTGAATCAGTC
CTTACACAAATGCAATCTGGAGAAAAAAGCCCATTTAGTCAGAATATCAAGGAAATGCAA
GAAATGAATGGTGGAGCTGGGGTATTTTATATCCCCCCACAAGAACATTTTGTCGACCTT
GAAGATGAAGACTGGAGATATGATGTCATGCCTGAGTTTTTTGAAGGGAAAAATGTTATG
GATTATATCGACCCTGATATTATGGACAAACTTAATGATTTAGAAAAAGAAGAAGAGGTT
TTAGATGATGCTCATGTACCTTTAGATTATGATGAAATGAGAGAGATTTATGAAATTAGA
AGGAAGATTTTCTTAAGACGTAAAAGAATACAACAAGAAAGTATGATAAGAAAAGGTACT
TTTAAACCAAAAAGAAAAGAATGGTCTGATGTTAGAGAAGGTCTTGAACAATTGGGTATT
GATCCGACTCCTCTTAAAGATAAAATTAAGGAAAAAAGGAAAAGGGAAGAATCACCTGAG
TTTACAAGTAATGTTGATATGGATATTGATGGGGATACTGGAGTTGAGACTATTAAAAAA
AGATTTAGGACTAAAAGCAAAAGTTTAGTTAAAGCAAGGAAACCTGGAACTATTAAAGAT
AATCCAGATAGAGAAACTTTGAAACATATGGCTAAGGTTGCTGATAAAAAGCACTTTGAC
ACTAAACCTAAGCATTTGAATACTGGAAAAAGCGGTATTGGCAAAAGAGATTATAGGTAG