Identifiers and Description

Gene Model Identifier

SteCoe_4339

Standard Name

None

Aliases

None

Description

Laminin_G_3 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_001913308.75651076269652e-27hypothetical protein
Oxytricha TrifallaxContig309.0.g683.1391327920480296e-17Giardia variant-specific surfa
ce protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_4339(Protein)
MALRLGIICLALRGILGNTLVEYRFGYNFGEVYRDYSGNSNDAVNGDSAYNTNRNTIATD
RGAYFKSGSENHITLPPNDFRTVALALPSTFTLMMWVFINDESYYFFIRNSTNGDNFGIY
RESNGDKICITTNFSGTYIKGELGSVLTTSKWNFFSFTIDNTSVKFYGNLENNKIISITI
SSYTEKSSFTSFIGCKKDTFNSFSGFIWNFIIVSTTITQSSYVGGASSNCIVPTCESPSC
PNSFINSTITGCISINSDSDKDSKNVNCPSGCNTSIYSCTSNTCLQCSCLYMSCVLNSTS
SATCWCPSNAYASGNTCICNDNNLTFDNFTCTLPCNADCLTCDASGIICTSCKDINALTT
NTGGCVCNSGYYNITALTSGGTCLQCNSQCKTCSEANKCLICKDSNAIAASTIGCECKSG
YYNTSSLIIDGACIKCNEQCSSCSKADKCLTCIDSNAYALDTIGCICHDGYYNTSSLIIN
GACLQCNSQCKKCSEANKCLICIDSNAIAASTIGCECKSGYYNTSSLIIDGACKKCNEQC
LSCSEADKCITCIDSNAYALSTIGCICHDGYYNTSPLIENGACSNCDSQCKTCSEANKCL
KCKDANAVIDSEIGCKCNSGYYGSASSTTLSTCKQCYSECSTCDKYPECTACINEYAELD
KNGSCICKSGYYSNLTLNIFDACIKCYDECSTCNEFPKCTTCIAEYAKPDLNGGCICKSG
YYRNSSLNVSDACIKCYDECLTCVEYSKCTSCITKNTILDFNARCICDSGYYNITPLTTE
NACIKCYNDCAECNEDLICSVCIADSATPNKNIGCVCNLGYYNTSALNNKNSCLKCYDEC
QSCIENLKCTSCIAKYAIINDAVGCVCEYGFYNTTRLINANACQLCSIECKSCEFSSDYC
IECIDGYNMTSDNRCVLCTEREYFDGNGCKSCPTLCKRCNGVCLECVDNAILNQSICSCI
DGYFPDDNKLSCESGYFECSISTNLNNNVKLSYTEPISEILDEMDFEIDINRDNTSIPFS
YKLYKLTSKDYIFQLNFINQPTSQCNLTLVILKNPLVSDTNKTLVNYIYSTYISFNPIIK
VKIIAKAASQAIVGASLGSSLISNPSSAWIFINTIEIISYIPLSNPPLSNRLIGFFQGIG
SFNPVPSIAGNIFDSNSTEAPYYEAYKYGFSTSVFLLNISPTLGIFFIVCICWPLLYLFS
KLEIGKISIKTIKILSNYKYSFFLRFWTQSFIIITLSAIIQIKSTVYMAFQGYFNQACAS
IAIVIAALTAPVLLISSYNYREKLFSNDDVFYKKFGCFYSEFKLNKGFLSSQYYAIFFLR
RFLFILAQVYLNNHPHTQNVMNILGSFIQVAFLIIYLPFKETSILISSLIGEITIFFTML
FCYLTYFFQNSLVLENLAISIVIIGMAGQFIITLFLTFMSFRILWLKIEKIRAKAILQTF
ENNKENNKENNKEKVKEILKFPSSEVERHNSIVIDEIDEINETSPGK


>SteCoe_4339(CDS)
ATGGCTTTAAGGTTAGGAATAATTTGTCTTGCTCTTAGAGGTATACTTGGAAATACCTTA
GTTGAATATAGATTTGGGTATAATTTTGGTGAAGTTTATCGTGACTACTCAGGCAACAGT
AATGATGCAGTCAATGGGGATTCGGCATATAATACAAATCGTAATACCATTGCTACAGAT
AGAGGAGCTTACTTTAAAAGTGGGTCAGAAAATCATATTACCCTTCCTCCTAATGATTTT
AGGACAGTAGCTTTGGCTCTTCCTTCAACTTTTACATTGATGATGTGGGTTTTTATAAAT
GATGAGAGCTATTATTTTTTCATAAGAAACAGTACAAATGGTGACAATTTTGGTATTTAC
AGAGAATCAAATGGAGACAAAATCTGTATAACAACCAATTTTTCAGGAACATATATAAAA
GGAGAATTAGGTAGTGTCCTTACAACAAGTAAATGGAACTTTTTTTCTTTTACAATCGAC
AATACTAGTGTTAAATTCTATGGAAACTTAGAAAATAATAAAATCATTTCAATTACAATC
TCAAGCTATACTGAAAAATCATCATTCACTAGTTTTATAGGCTGTAAAAAAGATACTTTT
AATTCTTTTTCAGGGTTTATATGGAATTTCATTATAGTATCGACAACAATAACTCAATCA
TCATATGTTGGAGGAGCATCTTCAAATTGTATTGTTCCTACTTGTGAATCTCCTTCATGC
CCAAATAGTTTTATAAACTCAACTATAACAGGATGTATTTCTATTAATTCAGACTCAGAT
AAAGATAGCAAAAATGTAAATTGTCCTAGTGGATGCAATACTTCTATATATAGTTGTACA
TCAAACACTTGCCTTCAATGCAGTTGTTTATATATGAGCTGTGTGCTTAACTCTACTTCT
TCAGCTACTTGTTGGTGTCCGAGTAATGCATATGCATCAGGTAATACATGTATATGTAAT
GATAATAATTTAACTTTTGACAACTTTACTTGCACTTTACCTTGCAATGCTGATTGTCTT
ACTTGTGATGCATCTGGAATAATATGTACTTCATGTAAGGATATTAATGCATTAACGACA
AATACAGGAGGGTGCGTATGTAATAGTGGTTATTATAATATAACTGCCTTAACTAGCGGA
GGTACTTGCTTGCAATGCAATTCTCAGTGCAAAACATGCTCTGAAGCAAATAAATGCTTG
ATTTGCAAAGACTCAAATGCTATAGCAGCAAGTACAATTGGTTGTGAGTGTAAAAGTGGA
TATTATAATACTTCATCTTTAATAATTGATGGAGCTTGTATAAAATGCAATGAACAATGC
TCATCTTGCTCAAAAGCAGACAAATGTTTAACTTGTATTGATTCTAACGCTTATGCTTTG
GATACAATTGGATGTATATGCCACGATGGCTACTATAATACATCGTCGCTTATTATAAAT
GGTGCTTGTTTGCAATGCAATAGTCAGTGCAAAAAATGTTCTGAAGCAAATAAATGCTTG
ATTTGCATAGACTCGAATGCTATAGCAGCAAGTACAATTGGTTGTGAGTGTAAAAGTGGA
TATTATAATACTTCATCTTTAATAATTGATGGAGCTTGTAAAAAATGCAACGAACAATGC
TTATCATGCTCAGAAGCAGACAAATGTATAACTTGTATTGATTCTAACGCTTATGCTTTG
AGTACAATTGGGTGTATATGCCATGATGGCTATTATAATACATCGCCGCTTATTGAAAAT
GGTGCTTGCTCAAATTGTGATAGTCAATGTAAAACATGTTCTGAAGCAAATAAATGTTTG
AAATGCAAAGATGCCAATGCTGTTATTGATTCAGAAATAGGCTGCAAATGTAATTCAGGA
TATTATGGCAGTGCTTCATCAACTACTTTAAGCACTTGCAAACAATGTTATTCTGAATGC
TCAACCTGTGATAAATATCCTGAATGCACTGCTTGTATTAACGAATATGCTGAACTAGAT
AAAAATGGAAGCTGCATATGTAAATCTGGTTATTACAGCAATTTAACTCTAAATATTTTT
GATGCATGCATAAAATGTTACGACGAATGTTCAACATGTAATGAATTTCCTAAATGTACT
ACTTGTATTGCCGAATATGCTAAACCAGATTTAAATGGAGGCTGTATATGTAAATCTGGT
TATTATAGGAATTCATCTCTAAATGTATCTGACGCATGCATAAAATGCTATGATGAATGC
TTAACCTGTGTTGAATATTCGAAATGCACATCTTGTATCACAAAAAATACTATTTTAGAT
TTTAATGCAAGATGTATATGCGATTCAGGATACTACAACATTACTCCCTTAACTACAGAA
AATGCATGTATAAAATGCTATAATGATTGTGCTGAATGCAATGAAGATTTAATATGTAGT
GTATGCATTGCTGATTCAGCTACTCCTAATAAAAATATAGGATGCGTATGTAATTTAGGG
TATTATAACACTTCAGCTTTAAATAATAAAAATTCTTGTTTAAAGTGTTATGATGAATGC
CAAAGCTGTATAGAAAACCTTAAATGCACTTCTTGTATAGCAAAATATGCTATAATTAAT
GATGCAGTAGGGTGTGTATGTGAATATGGATTTTATAACACAACAAGGCTTATTAATGCT
AATGCATGCCAACTTTGTTCAATAGAATGTAAAAGTTGTGAATTTTCTTCTGATTATTGC
ATCGAGTGCATTGATGGATATAATATGACAAGTGATAATAGGTGTGTTTTATGCACTGAA
AGGGAATATTTTGATGGTAATGGATGCAAAAGTTGTCCTACTTTATGTAAAAGATGTAAT
GGTGTTTGTTTAGAATGCGTTGATAATGCTATTCTAAACCAAAGTATTTGCTCATGCATA
GATGGGTATTTTCCAGATGACAATAAGTTATCTTGTGAAAGTGGTTATTTCGAATGCAGT
ATTTCCACAAATTTAAATAATAATGTAAAACTATCATATACAGAGCCAATATCTGAAATA
CTTGATGAAATGGATTTTGAAATTGATATTAATCGGGATAATACATCAATACCATTTTCT
TATAAACTTTATAAACTTACAAGCAAAGATTATATTTTTCAGCTAAATTTCATAAACCAG
CCAACTTCTCAGTGTAATTTAACACTTGTAATATTAAAAAATCCCTTAGTAAGTGATACA
AATAAAACATTAGTCAACTATATTTATTCAACATACATATCTTTCAACCCTATAATAAAA
GTTAAAATAATAGCTAAAGCTGCATCTCAAGCCATAGTTGGAGCATCATTAGGATCATCT
CTGATATCAAATCCATCTTCTGCATGGATATTTATAAACACTATTGAAATTATTTCATAT
ATTCCATTAAGCAATCCTCCACTCTCTAATCGACTCATTGGATTTTTTCAAGGAATAGGA
AGTTTTAACCCAGTTCCAAGCATTGCTGGGAATATTTTTGACAGCAACTCAACCGAAGCT
CCATATTACGAAGCATATAAATACGGATTTTCCACTTCAGTATTTTTATTAAACATCAGC
CCAACACTTGGTATTTTTTTTATTGTTTGTATTTGCTGGCCTTTACTTTATTTGTTTTCT
AAGTTAGAGATTGGTAAAATATCCATAAAAACAATTAAAATTTTATCGAATTATAAATAC
AGTTTTTTCTTAAGATTTTGGACCCAAAGTTTCATTATAATAACACTATCAGCTATAATC
CAAATAAAATCTACGGTATATATGGCATTTCAAGGATATTTTAATCAAGCATGTGCTTCA
ATTGCTATTGTAATTGCAGCATTAACAGCACCAGTTTTGTTGATTTCTTCTTATAATTAT
CGAGAAAAACTTTTTTCAAATGATGATGTTTTTTATAAGAAATTTGGGTGCTTTTACTCT
GAGTTTAAACTGAATAAAGGGTTTTTAAGCTCACAATATTATGCTATTTTCTTTTTAAGG
AGGTTTCTGTTTATATTGGCTCAAGTATACTTGAACAATCATCCACATACGCAAAATGTT
ATGAATATATTAGGATCTTTTATACAAGTAGCATTTCTTATAATATATCTTCCTTTTAAG
GAAACATCAATCCTAATATCAAGTCTTATCGGTGAAATTACCATATTTTTCACAATGCTT
TTTTGCTACTTGACCTATTTTTTCCAAAATTCTTTAGTTTTAGAAAATTTAGCGATTTCT
ATAGTTATCATAGGAATGGCAGGACAATTTATTATAACATTATTTTTGACTTTTATGTCT
TTTCGCATTTTATGGCTAAAGATTGAAAAAATAAGAGCTAAAGCTATTTTACAGACATTT
GAAAATAATAAAGAAAATAATAAAGAAAATAATAAAGAAAAGGTCAAAGAAATACTAAAA
TTTCCGTCAAGTGAAGTCGAAAGACATAATAGTATAGTCATAGATGAAATAGATGAAATA
AATGAAACAAGCCCTGGCAAGTAA