Identifiers and Description

Gene Model Identifier

SteCoe_4363

Standard Name

None

Aliases

None

Description

CH domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_001365102.970445045520691e-73fimbrin-like 71 K protein
Oxytricha TrifallaxContig10286.0.1.g445.96629836401057e-72Calponin homology (CH) domain

Saccharomyces CerevisiaeYDR129C2.3455513385429143e-59Fimbrin, actin-bundling protei
n; cooperates with Scp1p (calp
onin/transgelin) in the organi
zation and maintenance of the
actin cytoskeleton; relocalize
s from plasma membrane to cyto
plasm upon DNA replication str
ess
WormBaseWBGene000224257.281290178321643e-33

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_4363(Protein)
MELFVAKVTQELHREIGYHSVTDEEKAGFANIISHTLRDDPDLASLLPIKPFGNDLFEKV
RSGVILCKLINAAHPGTIFEKAINIKSNINIFQITENLNLAINAAKSIGCTVVSIHPESI
IEQREYLILGLIWQIIKILMLSKVNLKNHPELIKLVEEGEELSDLLKMSPEVILLRWFNY
HLKHAGTTRRVSNFENDIKDSECYTLLLNQIDPSRCDKSALTIEDLSARAGKVIENAIRI
GVDSPITPNNIVSGNAKLNIIFAAGIFNNNPGLHATEQELYEAAGLLNDDAEGTREERSF
RMWINSLGIDGLYINNLYEDVRDGLAILKVIDKVEPGTVNWKRVEMKTNHRLKRLANCGL
VIEYGRALGFTLIGVGNMDFVDGRKKLILGYVWQLVRFATLKLVGSMTEEALMKWANSRV
TTKANNFRDKSIGSGRFLIELFGSIESRAINWDLVTPGENPEGKEQNSKYIMSLARKLGG
SVFCTWEDIVEVNPKMIMTVIATAYHIAQTYRST


>SteCoe_4363(CDS)
ATGGAACTATTTGTGGCAAAAGTAACCCAAGAGCTCCATCGTGAAATTGGTTACCATTCA
GTGACTGATGAAGAAAAAGCTGGTTTCGCTAACATAATCAGTCATACTCTGCGTGATGAT
CCTGACCTTGCCTCACTTTTACCAATCAAACCTTTCGGTAATGACCTCTTCGAAAAAGTA
CGTTCAGGAGTCATTCTCTGTAAACTTATCAATGCTGCCCATCCAGGGACGATATTTGAA
AAGGCAATAAATATCAAGTCAAACATCAACATCTTCCAAATCACAGAAAATCTAAACCTC
GCTATAAATGCAGCTAAATCTATAGGCTGTACTGTTGTCTCAATACACCCAGAGTCTATA
ATCGAACAACGTGAATATCTTATCCTTGGGCTTATATGGCAGATAATCAAAATCCTCATG
CTTTCAAAAGTCAATCTTAAAAACCATCCTGAACTTATTAAACTTGTGGAGGAAGGTGAA
GAGCTTAGTGACTTATTAAAAATGTCCCCAGAAGTTATTCTTTTAAGATGGTTTAATTAT
CATCTTAAGCATGCAGGAACTACAAGACGTGTAAGTAACTTTGAAAATGATATTAAAGAT
AGTGAATGTTATACTTTGTTACTTAATCAAATCGATCCTTCTAGATGTGATAAATCAGCT
TTGACAATTGAAGATTTAAGTGCTAGAGCTGGAAAGGTTATTGAAAATGCAATAAGAATA
GGTGTAGACTCTCCTATAACACCTAATAATATAGTAAGTGGGAATGCTAAACTCAATATA
ATATTTGCTGCGGGTATATTTAATAATAACCCTGGATTACATGCAACAGAACAAGAGTTA
TATGAAGCAGCAGGGTTATTAAATGATGATGCAGAAGGTACTCGTGAAGAGAGATCATTT
AGAATGTGGATAAATTCTTTGGGTATTGATGGACTTTATATAAACAATTTATATGAAGAT
GTTAGAGATGGCTTAGCAATACTTAAGGTTATAGACAAAGTAGAGCCAGGGACGGTAAAT
TGGAAACGAGTTGAGATGAAGACTAATCACAGATTAAAAAGACTGGCAAATTGTGGACTT
GTTATAGAGTATGGTCGAGCTTTAGGATTTACATTGATTGGTGTGGGGAATATGGATTTT
GTAGATGGACGTAAAAAGCTTATATTAGGATATGTTTGGCAATTGGTTAGATTTGCTACA
TTGAAACTTGTTGGGTCAATGACTGAAGAAGCTTTAATGAAATGGGCTAATAGTCGAGTT
ACTACTAAAGCTAACAATTTTAGAGATAAGTCTATTGGAAGTGGAAGATTTCTTATTGAA
CTTTTTGGGTCGATTGAATCTAGAGCTATTAATTGGGACCTTGTCACACCAGGAGAAAAC
CCTGAAGGGAAGGAACAGAATTCAAAGTATATCATGTCGTTAGCTCGTAAACTTGGAGGC
AGCGTGTTTTGCACATGGGAAGATATTGTTGAAGTGAACCCAAAGATGATCATGACTGTT
ATAGCGACAGCTTATCATATTGCTCAGACTTACCGTTCAACTTAG