Identifiers and Description

Gene Model Identifier

SteCoe_4518

Standard Name

None

Aliases

None

Description

ATP-synt_D domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • ATPase activity, coupled to transmembrane movement of substances (IEA) | GO:0042626

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig13440.0.g1064.780892883885469e-25ATP synthase subunit D

Tetrahymena ThermophilaTTHERM_008218705.242885663363464e-22V-type ATPase, D subunit famil
y protein
WormBaseWBGene000101301.4251640827409352e-21
Saccharomyces CerevisiaeYEL051W3.873997628687187e-21Subunit D of the V1 peripheral
membrane domain of V-ATPase;
part of the electrogenic proto
n pump found throughout the en
domembrane system; plays a rol
e in the coupling of proton tr
ansport and ATP hydrolysis; th
e V1 peripheral membrane domai
n of the vacuolar H+-ATPase (V
-ATPase) has eight subunits

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_4518(Protein)
MSSTRVVANRSQLQMWKGKLQGATKGHSLLKRKLEGLKKEFSAVMAKLIKTKKKIGKMMI
TSVYLLTEAQWGAGDFGKTLADTVKRSSSQVELILKHKGGIYLPKFKSKHQEIEDPTRQL
GITGGGTSIQKTKAEFTKLLTELVKIAGLQVSYHTLDDVIRITSRRVNALENVVIPRFQG
FIDYILRELDEMEREDFFMLKKVQENKKKQMEKARLIREAEQEQGIDHDNGDSMLAQVKD
EDIIF


>SteCoe_4518(CDS)
ATGTCATCTACCAGAGTTGTTGCCAATAGAAGCCAGCTGCAGATGTGGAAAGGAAAATTG
CAAGGTGCAACAAAAGGCCACTCATTGCTTAAAAGAAAACTTGAAGGGCTTAAAAAGGAA
TTCAGTGCTGTCATGGCCAAATTGATAAAAACCAAAAAAAAGATCGGAAAAATGATGATC
ACTTCTGTCTATCTCCTAACCGAAGCTCAATGGGGTGCAGGGGATTTCGGTAAAACTCTT
GCTGATACTGTAAAAAGGAGTTCTAGCCAAGTTGAACTAATACTAAAACATAAAGGTGGT
ATTTATCTGCCAAAATTCAAATCAAAACATCAAGAAATCGAAGATCCAACAAGGCAGCTT
GGTATAACTGGTGGAGGTACAAGTATTCAAAAGACTAAAGCTGAATTCACTAAGCTTTTG
ACTGAGCTTGTGAAAATTGCTGGTCTTCAAGTATCTTATCATACACTAGATGATGTGATT
AGAATTACAAGTCGTCGTGTTAATGCTTTAGAAAATGTTGTCATTCCTCGTTTTCAAGGA
TTTATCGATTATATTCTTCGTGAATTAGATGAAATGGAAAGAGAAGATTTTTTCATGCTT
AAGAAAGTACAGGAAAATAAAAAGAAACAGATGGAAAAAGCTAGGCTGATAAGAGAAGCT
GAACAGGAGCAAGGAATAGATCATGATAATGGCGATTCTATGTTGGCTCAAGTTAAAGAT
GAAGATATTATTTTTTAG