Identifiers and Description

Gene Model Identifier

SteCoe_4950

Standard Name

None

Aliases

None

Description

UDG domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig4825.0.g108.985825944049381e-37Uracil DNA glycosylase superfa
mily

Tetrahymena ThermophilaTTHERM_007942503.6251409191435593e-34uracil-DNA glycosylase family
protein
WormBaseWBGene000132411.185064864233981e-27
Saccharomyces CerevisiaeYML021C9.602680054508676e-24Uracil-DNA glycosylase; requir
ed for repair of uracil in DNA
formed by spontaneous cytosin
e deamination; efficiently exc
ises uracil from single-strand
ed DNA in vivo; not required f
or strand-specific mismatch re
pair; cell-cycle regulated, ex
pressed in late G1; localizes
to mitochondria and nucleus

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_4950(Protein)
MDKFVTRKSSETSKQPEEEKKAPPKAQKKTKKSQNPEENSTANPSAPQGQSSDISYDNWL
EQMDSSWRTALDSYLTGGKLRNIYTWVSREYSEHTCRPPAGEIFTAFRLTPFNNIKVVVV
GQDPYPGPVEAMGLSFSVHRGVAVPGSLRNIYKCLQQDKKLNFTPQKHGDLSAWARQGVF
MLNAVLTVRQGSANSHSKKGWESFTDEVIKVINRDCNGVVFMLWGAYAQEKAKSVDKKKH
LILEACHPSPLSASKGGFYSCGHFSRANEYLKSVGKTEIDWRLDG


>SteCoe_4950(CDS)
ATGGATAAATTCGTCACTCGGAAATCGTCAGAAACTTCCAAACAACCCGAAGAAGAGAAA
AAAGCCCCACCAAAAGCACAAAAAAAGACTAAAAAATCCCAAAACCCTGAAGAAAATTCT
ACAGCCAACCCTTCCGCGCCTCAAGGACAATCGTCTGATATATCATATGACAATTGGCTT
GAACAAATGGACAGCTCATGGAGAACAGCTTTAGATAGTTACTTAACTGGAGGAAAACTT
CGAAATATATACACTTGGGTAAGTAGAGAATATAGCGAACATACTTGTAGACCACCTGCA
GGAGAAATATTTACCGCTTTCAGGCTTACTCCATTTAACAACATAAAAGTTGTAGTTGTA
GGACAAGACCCTTATCCTGGACCAGTTGAAGCTATGGGATTAAGTTTTTCTGTTCATAGA
GGAGTCGCTGTCCCTGGAAGTTTAAGAAACATATATAAATGTTTGCAACAAGATAAAAAA
CTAAACTTTACTCCACAGAAACATGGAGATTTATCAGCATGGGCTCGTCAAGGAGTTTTT
ATGCTTAATGCAGTACTTACAGTAAGACAAGGTAGCGCGAATTCACATTCGAAAAAAGGG
TGGGAAAGCTTTACTGATGAGGTTATCAAAGTAATTAACCGGGATTGTAATGGAGTAGTT
TTTATGCTATGGGGAGCTTATGCACAAGAAAAAGCTAAATCTGTTGATAAGAAAAAACAT
TTAATCCTTGAAGCATGTCATCCTTCACCACTCTCAGCATCAAAAGGTGGCTTTTATTCA
TGTGGACATTTTTCAAGAGCTAATGAGTATTTGAAAAGTGTTGGTAAGACTGAGATTGAT
TGGAGACTTGATGGATAA