Identifiers and Description

Gene Model Identifier

SteCoe_5004

Standard Name

None

Aliases

None

Description

WD40 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22582.0.g1053.5722699376192174e-67WD domain, G-beta repeat

Tetrahymena ThermophilaTTHERM_004945708.628801156620959e-60pre-mRNA-splicing factor
WormBaseWBGene000186251.8521167695179754e-45
Saccharomyces CerevisiaeYDR364C3.975449735908647e-31Pre-mRNA splicing factor; impo
rtant for catalytic step II of
pre-mRNA splicing and plays a
role in cell cycle progressio
n; required for DNA synthesis
during mitosis and meiosis; ha
s WD repeats

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_5004(Protein)
MDFIFSESDSESINFPSTSKLSLAPDVIIPQTPVSILSTPILQKIELHSQSFKDLFYKQE
NFNNTIDQPSEKTVFTKSTPSQIEHKLQLKNKRVKNDDPTSGDFLGPWAHYSGEELLFAG
RYQEIDEEQKAKLAELEEKRQKKIVESRDKPIVKDYEKTDIVINDAKILTHVDKSLDYQG
RSIFDTPSDLKIDPNNVAYIPKKCKQTLAGHTKGVQCVKFHKDGHLMLSASLDHTVKIWD
AVGSKKCIQTYIGHTNSVRDICWSMDCTSFLSCSYDRLIRHWDTETGKVLCTFTCRRIPY
CVKFNPDPEKLSSFIVGTANKKIVEYDTYTGKKERTYDEHLGAVNSLCFMDNNKKFVSTS
DDKKVFLWEFGIPVVTKHISEPNLHAIPYTVLHPNNRHFVGQCLDNRLVVFEARGGFRLN
RRKKFVGHMNGGFACSVAFSPDGQFVTSGDANGRIWFWDWQTTKNYRTLQAHNDVVIGID
WHPVFPSVVATCSWDGVIKIWD


>SteCoe_5004(CDS)
ATGGATTTTATATTCTCTGAGTCTGACTCCGAGTCAATAAACTTCCCATCGACATCCAAA
CTATCACTTGCTCCTGATGTTATAATCCCCCAAACTCCAGTATCAATATTATCAACTCCG
ATTCTTCAAAAAATTGAGCTACACAGCCAATCATTCAAAGACCTTTTCTATAAACAAGAA
AACTTTAACAACACAATAGACCAACCATCTGAAAAAACAGTCTTTACAAAATCGACTCCA
AGTCAAATCGAACACAAACTTCAACTCAAAAACAAACGAGTAAAAAATGATGATCCAACA
TCTGGGGATTTCCTCGGTCCTTGGGCTCATTATTCAGGAGAAGAGTTGCTTTTTGCAGGT
CGATACCAAGAAATAGACGAAGAACAAAAGGCAAAACTAGCAGAACTCGAAGAAAAAAGG
CAGAAAAAAATCGTCGAATCCCGAGATAAACCAATAGTAAAAGACTATGAAAAAACAGAC
ATTGTGATAAATGATGCGAAAATTTTAACACATGTAGACAAAAGCTTAGATTATCAAGGC
CGGAGTATTTTCGACACCCCTTCCGACTTGAAAATTGACCCAAATAATGTTGCATATATT
CCGAAAAAGTGTAAACAAACCTTAGCAGGACATACAAAAGGTGTTCAATGTGTTAAATTC
CATAAAGATGGACATCTTATGTTATCTGCATCATTAGATCATACAGTTAAAATATGGGAT
GCTGTTGGAAGTAAAAAATGTATTCAAACTTATATTGGGCATACAAATTCTGTTAGGGAT
ATATGTTGGAGTATGGATTGTACTAGTTTTTTATCTTGTTCTTATGATAGGTTAATAAGA
CATTGGGATACTGAAACTGGGAAAGTTTTATGTACTTTTACTTGTAGAAGAATTCCTTAT
TGTGTAAAATTTAACCCTGATCCTGAGAAACTTTCATCATTTATTGTTGGTACTGCTAAT
AAGAAAATTGTTGAATACGATACGTATACAGGGAAAAAAGAAAGGACTTATGATGAGCAT
TTAGGTGCTGTGAACTCATTATGTTTTATGGACAATAATAAAAAATTCGTCTCAACAAGT
GACGATAAAAAAGTTTTTCTTTGGGAATTTGGTATCCCAGTTGTAACAAAACATATTAGT
GAGCCTAATTTACATGCAATACCATATACGGTTTTACATCCTAACAATAGGCATTTTGTA
GGACAATGTTTAGATAATAGACTTGTTGTATTTGAAGCTAGAGGTGGTTTTAGGCTTAAT
AGAAGGAAGAAATTTGTTGGTCATATGAATGGAGGTTTTGCTTGTTCTGTTGCTTTTTCA
CCTGATGGACAGTTTGTGACAAGTGGTGATGCTAATGGAAGGATTTGGTTCTGGGATTGG
CAGACTACAAAAAATTATAGGACTTTACAAGCTCATAATGATGTTGTGATTGGTATTGAT
TGGCATCCGGTTTTCCCTTCTGTTGTTGCTACTTGCAGTTGGGACGGTGTTATTAAAATA
TGGGATTAG