Identifiers and Description

Gene Model Identifier

SteCoe_5094

Standard Name

None

Aliases

None

Description

EF-hand_7 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22680.0.g503.873997628687187e-21EF hand

Tetrahymena ThermophilaTTHERM_010756207.781132241133797e-20Light chain subunit of ciliary
three-headed outer arm dynein
(OAD)"
WormBaseWBGene000005520.0000000007582560427911907

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_5094(Protein)
MILNEDQISKCKSIFSQFDKDGTGRIDRFELRVVLERKSYIEMGQKPTEEELFSMINEVD
ENNTGKIEFYEFLKVYEKNQKAHDRDDEEDLIDAFVAMGGNKDKTGIIDTEKLINVIRHQ
FEMTIDIEKLIEEIDEDQNHTIDFDEFKRLLSSNY


>SteCoe_5094(CDS)
ATGATCTTGAACGAAGACCAAATCTCTAAGTGCAAAAGTATTTTCAGCCAATTTGACAAA
GATGGAACAGGGCGAATCGACCGCTTTGAACTAAGAGTCGTATTAGAACGTAAATCTTAT
ATAGAGATGGGACAAAAGCCTACAGAAGAAGAACTATTTTCCATGATCAATGAAGTTGAT
GAAAACAATACAGGGAAAATTGAATTTTATGAGTTCCTGAAAGTTTATGAAAAAAACCAA
AAAGCTCATGACAGAGATGATGAAGAGGATTTAATTGATGCATTTGTCGCGATGGGTGGA
AATAAAGATAAAACAGGGATTATAGACACTGAAAAATTAATAAATGTTATAAGACACCAG
TTTGAGATGACTATTGATATAGAAAAACTCATAGAAGAAATAGATGAAGACCAAAATCAT
ACTATCGACTTTGATGAATTTAAACGTTTGCTTAGCAGTAATTATTAG