Identifiers and Description

Gene Model Identifier

SteCoe_5175

Standard Name

None

Aliases

None

Description

Utp11 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003162400.00000000000003442477108469977Subunit of U3-containing Small
Subunit (SSU) processome comp
lex involved in production of
18S rRNA and assembly of small
ribosomal subunit
Oxytricha TrifallaxContig17879.0.g650.0000000000006914400106940203Utp11 protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_5175(Protein)
MSSFKKAIPKRKYRERSQPAHRQHLGMLEKKQDYKLRSEDTHKKEKILKDLYEKVQNKSP
DEFYFGMQNTRIIGGKHRKESQFIEPEKVKKQKILDGNLLNMKVMNKISQSEKLKESLHL
IDAPAPNKHIIFVDNSDKLETFDLAKHFDTVPELINNKSNRLTVSQLSSVKLQEYPEPEG
YQELEVLAQEEKIVSKSLEKNILSRKLLGKEKYKVIDEEKKQYKWFRERKR


>SteCoe_5175(CDS)
ATGTCGAGCTTTAAAAAAGCAATCCCAAAGCGCAAGTATAGAGAAAGGTCACAACCAGCT
CATCGACAGCACTTAGGGATGCTTGAAAAAAAGCAAGACTATAAACTAAGATCCGAAGAT
ACTCACAAAAAAGAGAAAATACTCAAAGATCTCTATGAAAAAGTTCAAAACAAAAGCCCT
GACGAGTTTTATTTCGGCATGCAAAATACAAGAATAATTGGAGGAAAGCACAGAAAAGAA
AGTCAATTTATAGAGCCTGAGAAAGTAAAAAAACAAAAAATCCTTGATGGGAACTTACTT
AATATGAAAGTTATGAACAAAATTTCTCAAAGCGAAAAACTTAAAGAATCTTTACATTTG
ATTGATGCCCCAGCACCTAATAAACATATTATATTTGTTGATAATTCAGATAAACTTGAA
ACATTTGATTTAGCAAAACATTTCGATACAGTACCAGAACTTATTAACAATAAATCAAAT
CGACTTACTGTGTCACAGCTTTCATCTGTTAAGCTTCAGGAATACCCAGAACCTGAGGGT
TATCAAGAGTTAGAAGTATTAGCGCAAGAAGAAAAAATTGTGTCAAAGTCTTTAGAAAAA
AATATTCTTTCACGTAAACTGCTAGGAAAAGAGAAATATAAAGTTATTGATGAAGAGAAA
AAACAATATAAGTGGTTTAGAGAAAGAAAAAGATAA