Identifiers and Description

Gene Model Identifier

SteCoe_525

Standard Name

None

Aliases

None

Description

DEAD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig17487.0.g990Helicase associated domain (HA
2)

WormBaseWBGene000033937.362997122252211e-76
Saccharomyces CerevisiaeYGL120C3.257488532207521e-70RNA helicase in the DEAH-box f
amily; functions in both RNA p
olymerase I and polymerase II
transcript metabolism; catalyz
es removal of U2, U5, and U6 s
nRNPs from the postsplicing la
riat-intron ribonucleoprotein
complex; required for efficien
t biogenesis of both small- an
d large-subunit rRNAs; acts wi
th Sqs1p to promote 20S to 18S
rRNA processing catalyzed by
endonuclease Nob1p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_525(Protein)
MSSNQVLPILEYQDEILNSLLHNQVLIVTGEPGCGKSTKLPQFCIDSKSLSQKLKTSKIS
VAVTQPRRVAAIAMAKRVSYERRCKLGTEVGYCIRFEDRSSLKTRIKYLTDGVLLRECMG
IKGLSNYNIIILDEAHERSLDTDILMGLLKSHLISNPKFRLIVTSATIDVNLFSKYFSNA
PIISVSGRQFDVEILHSACKSDRRVEYVVNAAIRIHLHEGPGDILAFLTGSDECESAKSL
CFETLQRLVSKGKSVASMLMLALYGAMSSEEQAKVFKPTPVDCRKVIFSTNISETSITVD
GIGFVIDCGYVKQKQFNPANSLDALTVVPISKQQAKQRTGRAGRTQAGKCFRLYSESFFN
EQMQENITAEIHRANLASVVLVLKSLGISNVTNFSFIEPPSGDKITQAYKLLYYIGALDE
TGDITLLGREIAKFPLDPAYSRCLVSSIICKCSSEMLTLVSLLSSENIWQNVPKSILTKY
EEAKNAQHAFLDKKGDHLTLLKVHEQWKSQGRKQQWCYDNYINYRSMLQADDIRDQLKAI
MRIIRVPSLIEDQLFEEFKTSLKTNLAKVRFALCIGFYMNAGRAIVYGQEGSYLAVRDNS
MLHVDKSASVAILDSYPTWIIYTQLSGTTLAHGTIKMLSKVKSEWLEQLVPKLEKINLNK
LLGLANEKRQRSDSENEEEKTEQVGENVKEKIEQAKQRYLKRKFN


>SteCoe_525(CDS)
ATGTCATCTAATCAAGTTTTACCTATCCTTGAATACCAAGATGAGATTTTAAACTCTCTT
CTACACAATCAAGTTCTTATTGTAACAGGTGAACCAGGTTGTGGTAAGTCTACTAAACTG
CCTCAGTTTTGCATAGACAGCAAATCTTTATCACAAAAGCTCAAAACAAGTAAAATTAGT
GTGGCTGTAACCCAACCAAGAAGAGTTGCGGCAATAGCCATGGCTAAACGCGTATCCTAT
GAGCGTAGATGCAAGCTTGGTACTGAGGTAGGATATTGTATTCGTTTTGAAGATCGTAGT
TCATTAAAAACACGTATTAAATACCTTACAGATGGTGTACTCCTAAGAGAATGCATGGGT
ATTAAAGGTCTTAGCAATTACAACATAATAATCCTTGATGAAGCTCATGAAAGAAGCTTA
GATACTGATATCCTAATGGGTCTTCTTAAATCCCATCTGATTTCCAACCCTAAATTCCGT
CTTATCGTAACTTCTGCAACCATAGATGTGAATCTTTTCTCTAAATACTTCTCAAATGCA
CCCATAATCTCAGTCTCAGGAAGACAATTTGATGTTGAAATCCTTCATAGTGCCTGCAAA
TCAGATCGAAGAGTTGAATATGTTGTTAACGCAGCAATTAGAATCCATTTGCATGAAGGC
CCTGGAGATATCCTAGCATTTCTTACAGGAAGTGATGAATGTGAAAGCGCTAAATCCTTA
TGTTTTGAAACTTTACAAAGACTTGTTTCTAAAGGTAAATCCGTAGCTTCAATGCTCATG
CTTGCTTTATATGGGGCAATGTCAAGTGAAGAACAAGCTAAAGTATTTAAACCAACCCCA
GTTGATTGTAGGAAAGTCATATTTTCAACAAACATATCAGAAACTTCAATAACTGTTGAT
GGTATTGGCTTTGTTATAGACTGTGGGTATGTCAAACAGAAACAGTTTAACCCGGCAAAT
AGTTTAGATGCTTTAACTGTAGTCCCAATATCAAAACAACAAGCAAAACAAAGAACAGGT
CGTGCAGGGAGGACACAAGCAGGGAAATGTTTCCGTTTGTATTCTGAGAGTTTTTTCAAT
GAACAAATGCAAGAAAATATAACTGCTGAAATACATAGAGCTAATTTAGCTAGTGTTGTT
TTAGTACTCAAAAGTTTGGGTATTTCTAATGTGACTAATTTCTCATTCATCGAGCCACCT
TCAGGAGATAAAATCACACAAGCTTATAAACTGCTGTACTATATAGGAGCTTTAGATGAA
ACTGGGGATATAACTTTACTTGGTAGGGAAATAGCAAAGTTTCCTTTAGACCCAGCTTAT
TCTAGATGTTTAGTTTCTAGTATTATATGTAAATGTTCATCAGAAATGCTCACTTTAGTT
TCATTACTTTCATCTGAAAACATATGGCAAAATGTACCAAAATCTATACTTACTAAATAT
GAAGAAGCTAAAAATGCTCAACATGCTTTTTTAGATAAAAAAGGTGACCATTTAACTTTA
CTTAAAGTACATGAGCAATGGAAATCACAAGGTCGTAAACAGCAATGGTGTTATGATAAT
TATATTAATTATAGAAGTATGCTTCAAGCTGATGATATAAGAGATCAACTTAAAGCTATT
ATGAGGATAATAAGAGTTCCAAGTTTAATTGAAGATCAGCTTTTTGAAGAGTTTAAAACA
TCGCTTAAGACCAATTTAGCTAAAGTTAGGTTCGCATTGTGTATAGGATTTTATATGAAT
GCTGGTAGGGCTATTGTTTATGGACAAGAAGGATCATATTTGGCTGTTAGGGATAATAGT
ATGTTACATGTGGATAAATCAGCAAGTGTAGCTATATTAGATTCTTATCCTACATGGATT
ATATATACACAATTGTCTGGGACAACTTTAGCTCATGGGACTATAAAAATGCTTAGTAAA
GTTAAAAGTGAATGGTTAGAACAATTAGTCCCAAAGCTTGAGAAAATCAATCTTAATAAA
CTTTTAGGCTTGGCTAATGAGAAAAGACAAAGATCGGATAGTGAGAATGAAGAGGAAAAA
ACAGAACAAGTAGGGGAAAATGTTAAAGAAAAAATAGAACAAGCTAAACAAAGATACTTA
AAACGCAAGTTTAATTAA