Identifiers and Description

Gene Model Identifier

SteCoe_5286

Standard Name

None

Aliases

None

Description

MST subfamily kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig1275.1.g503.257488532207521e-70Protein kinase domain

Tetrahymena ThermophilaTTHERM_009331001.5400882849875202e-51Protein kinase domain containi
ng protein. Sequence similarit
y to the MST subfamily of the
protein kinase STE20 family (E
isen et al., 2006)."
WormBaseWBGene000160383.392270193026015e-47
Saccharomyces CerevisiaeYHL007C5.900090541597061e-29Cdc42p-activated signal transd
ucing kinase; involved in pher
omone response, pseudohyphal/i
nvasive growth, vacuole inheri
tance, down-regulation of ster
ol uptake; GBB motif binds Ste
4p; member of the PAK (p21-act
ivated kinase) family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_5286(Protein)
MQDLNIQDVVSNHEDPEEMFQLLEKLGEGSYGSVIKGLHISSGTIVAIKIVPINNEIASL
KKEISILKQCRHPNIVGYIGSYIKKGNLWLIMEYCSAGSVADLIKVTKRTLDEVQIASVC
QAALRGLEYLHDNKKIHRDIKAGNVLLDHKGIAKLADFGVSAQLANTLSKKDTVIGTPYW
MSPEVISRSLYNKKTDIWSLGITAIEMAEGEPPYSHIHPVRAMFAIQKSPAQGLTEPHKW
SNEFNDFVKKCLTIDPKQRPTAKELLIHSFIRRNRGPSLLSELVANSMESLERYRSMQTH
DDSDEFIDDNDDDDDDESDSKMNSVVYKGTNNYDSGTMIEYGTIVENGEENKMNTIIIKD
EKVDNSTMKVVNEENTGEPEFMKYVREVEGFPEPVVVKPIPPPQPVVKPPQPTQYVVKTP
QLVQPVVKSSFVESQPKAEIPPELRGMSVEYMEKTLTRLKVDMEAEIDVIRTKYSERIKL
FENALKAIKSNERKRK


>SteCoe_5286(CDS)
ATGCAAGATTTAAACATCCAAGACGTAGTGTCAAATCACGAAGATCCTGAAGAAATGTTC
CAACTTCTCGAGAAGCTTGGCGAAGGGTCTTATGGATCAGTGATCAAAGGTCTTCACATA
TCATCCGGGACAATTGTGGCAATCAAAATAGTTCCAATCAATAATGAAATTGCAAGTTTA
AAGAAAGAAATCTCAATCCTCAAGCAATGTCGTCATCCAAACATAGTCGGCTACATAGGT
TCTTATATAAAAAAAGGCAACCTTTGGTTGATCATGGAATACTGTAGTGCCGGGTCAGTA
GCCGACTTGATAAAAGTGACAAAAAGGACTTTAGATGAAGTTCAAATAGCCAGTGTATGT
CAAGCAGCATTAAGAGGTTTAGAGTATCTTCATGATAACAAAAAAATCCATAGAGACATC
AAAGCTGGAAATGTGCTTCTAGATCATAAAGGAATAGCTAAATTAGCTGATTTTGGAGTT
TCAGCTCAACTAGCAAATACTCTTTCTAAAAAAGATACTGTAATAGGAACACCTTACTGG
ATGAGTCCTGAAGTAATTTCCCGATCGCTTTATAATAAAAAAACTGACATTTGGTCTTTA
GGGATCACTGCTATTGAAATGGCTGAAGGGGAACCTCCTTATTCTCATATACACCCTGTT
AGGGCTATGTTTGCCATACAAAAAAGCCCAGCTCAGGGTCTTACTGAGCCTCATAAATGG
TCGAATGAATTTAATGACTTTGTTAAGAAATGCTTGACTATTGACCCTAAACAAAGACCT
ACAGCTAAAGAATTACTTATCCATAGTTTTATTAGAAGAAATAGAGGACCGAGTCTTTTA
AGTGAATTAGTTGCCAATTCAATGGAATCTTTAGAACGCTATCGGTCAATGCAAACGCAT
GATGATAGTGATGAATTTATAGATGATAATGACGATGATGATGATGATGAAAGTGATAGC
AAAATGAATAGTGTTGTTTATAAAGGGACGAATAATTATGATTCTGGGACTATGATTGAA
TATGGAACTATTGTAGAGAATGGTGAAGAGAATAAAATGAATACGATTATTATTAAAGAT
GAGAAAGTTGATAATTCGACAATGAAAGTTGTTAATGAAGAAAATACAGGAGAACCTGAG
TTTATGAAGTATGTTAGAGAAGTTGAAGGGTTTCCTGAACCTGTTGTTGTAAAACCAATT
CCACCACCTCAACCTGTTGTGAAACCCCCTCAACCAACTCAATATGTTGTGAAAACACCT
CAATTAGTTCAACCTGTTGTGAAAAGTAGCTTTGTTGAAAGCCAACCTAAAGCAGAGATA
CCTCCAGAATTAAGAGGAATGTCTGTAGAGTATATGGAAAAAACTTTAACTAGGCTGAAA
GTTGATATGGAAGCTGAAATTGATGTTATTAGAACTAAGTATTCTGAAAGAATTAAACTC
TTTGAAAATGCTTTGAAAGCTATTAAGTCTAATGAAAGAAAAAGAAAGTAA