Identifiers and Description

Gene Model Identifier

SteCoe_5449

Standard Name

None

Aliases

None

Description

Ribosomal_S17_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22520.0.g952.4426007377405277e-36Ribosomal protein S17

Tetrahymena ThermophilaTTHERM_011097704.906094730649281e-35Homolog of yeast RPS11, human
RPS, bacterial RPS17;
Saccharomyces CerevisiaeYDR025W5.900090541597061e-29Protein component of the small
(40S) ribosomal subunit; homo
logous to mammalian ribosomal
protein S11 and bacterial S17;
N-terminally propionylated in
vivo; RPS11A has a paralog, R
PS11B, that arose from the who
le genome duplication
WormBaseWBGene000044801.185064864233981e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_5449(Protein)
MADVQTERAFQKQEIVSLRTKKFLTKKTSAGVRYWKNVGLGFKTPKSASEGTYIDKKCPF
TGNVSIRGRILRGMVVSTKMKNTVVIRRNYLHYIPKYSRFEKRHTNISAHCSPAFDTIKE
GDIVTIGQCRPLSKTVRFNVLKVQPNQIFGAARKQFVLF


>SteCoe_5449(CDS)
ATGGCCGACGTTCAGACTGAAAGAGCCTTCCAAAAGCAAGAAATCGTCTCTCTGCGCACC
AAGAAGTTCTTGACCAAAAAGACCTCTGCTGGTGTAAGGTACTGGAAGAACGTAGGTCTA
GGATTCAAAACCCCAAAATCTGCCTCCGAAGGCACTTACATCGATAAAAAATGCCCATTC
ACAGGCAACGTCAGTATCCGCGGAAGAATCCTCAGAGGCATGGTTGTTTCAACTAAAATG
AAAAACACTGTCGTCATCAGAAGAAACTACCTTCACTACATCCCAAAATACAGTCGTTTT
GAAAAAAGGCATACAAACATTTCTGCTCACTGTTCCCCAGCTTTCGATACTATCAAAGAA
GGTGATATTGTGACAATTGGCCAATGCAGACCTTTATCAAAGACTGTTAGATTCAATGTC
CTCAAGGTTCAGCCAAACCAAATCTTTGGAGCCGCAAGAAAACAATTCGTACTATTCTAA