Identifiers and Description

Gene Model Identifier

SteCoe_5614

Standard Name

None

Aliases

None

Description

IBN_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12471.0.0.g1072.7487850079102147e-43hypothetical protein

Tetrahymena ThermophilaTTHERM_005481401.2160992992528256e-37Importin-beta N-terminal domai
n containing protein;
Saccharomyces CerevisiaeYER110C4.780892883885469e-25Karyopherin beta; mediates nuc
lear import of ribosomal prote
ins prior to assembly into rib
osomes and import of histones
H3 and H4; localizes to the nu
clear pore, nucleus, and cytop
lasm; exhibits genetic interac
tions with RAI1
WormBaseWBGene000020770.0000008315287191035679

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_5614(Protein)
MEYPASPNPEQLALLLGQVISGQNSQDLEKYFKRYLKLSQCVPDLMQQMMQNPVPNVRQL
ASVLLRKRIMKHWKALTPEVQGEVKKALIDRITNEPENLVRKNVASLTAALASNILAEWP
ELLAFIGTCTECQIVAAKEIGLYLLAELLENPDVCNILKPHQEKLTLLFASSLDDASSRD
IRKYALKALGNHALNSEEETPTNYILTLIPKIANVLSECVDNLDEELIVSAFEVFDSLID
SGQDITSNIELLIRIGLEKVGANSKLQLSTRECALDFLETIADMKPKILTSSPEMVRYLL
TNIFTIATEIDDNGDEPTCVDMAMRLLDTLALTLPNKTVYPHVFELSSHLRANPQARMRK
IGVLALGVIAEGCADYVKQDLANVVNILLQGLQDPDVAVREGAGLSMGYCAEHLKPDILD
LHSIILPQLLNLLDFNNIKVKQKALYAIDIFCEYFDDDIEQYLPTLVNKLMFLTVNESDS
KVKEMAVSALTSAISSAELKIVPYFLPIVRLLGDILQAADKEMNLKAMSLQCLGTLASSS
TIELFTPYIADSVNVAFAFLSGEVLEQREAGFAFFYSLSKLLKVQIEPYADRIIAEALKS
CEAQEGTKIEVVNEDNDDSDDEEAESVYKVRTVFLDEKTAALHTLGNLAIACPGKVLASM
QRIEANLDVLFDYFHENIRMQCVTTAQQLVEGLSQLPGGIQNIHDYWYMKVIHNYMEMLV
EDESKEVVIRVLEAIEELLKKIGTVLIPDNTMPLLIDQFVVLLDEGAACQKQGDETEGDH
DESLMGDFCDTLMQMAKDWKEAFSMHFEKLLPGIEKFTRSERNMRDRILFTGLLADTLKH
MPSVATKYAMNFAVLVERNLGGDDASIYRNTLYYLGVLCEAAPVLSSEYNKFLQLLQPFF
TNTFEPATVDNAVAAVCRMIITNPASIPLESVLPVLYSKLPLKDDFDEFKTVIRLIVFLY
SNPGLNLSVYNELSLKLLIEAVIVDSNDTDKYKIDTDTRDKAKALIHSFKGQPLLENLIA
ALAPESQNVLIKIL


>SteCoe_5614(CDS)
ATGGAGTACCCTGCCTCGCCAAACCCCGAGCAGCTTGCTTTACTTCTAGGACAAGTAATA
TCAGGGCAAAATTCACAGGATCTCGAAAAGTACTTCAAAAGGTACCTAAAACTGAGCCAA
TGCGTTCCAGACCTTATGCAACAAATGATGCAGAACCCAGTTCCCAATGTCAGACAGCTA
GCCAGTGTTCTTTTACGTAAAAGAATCATGAAGCATTGGAAAGCTTTAACCCCTGAAGTC
CAAGGCGAAGTCAAAAAAGCCTTGATCGATCGGATCACAAATGAGCCAGAGAACTTAGTC
CGCAAAAATGTGGCAAGTCTTACCGCAGCTCTAGCCAGTAACATTCTCGCTGAATGGCCT
GAGCTACTCGCTTTCATTGGTACCTGCACCGAATGTCAGATTGTCGCAGCTAAAGAAATA
GGCCTTTATTTACTAGCTGAGCTCCTAGAAAACCCTGATGTCTGCAACATCTTAAAACCT
CATCAAGAGAAACTTACCCTACTCTTTGCATCATCTTTAGACGACGCTTCCAGCCGTGAT
ATCAGAAAATATGCTCTTAAAGCATTAGGTAATCACGCTTTAAACTCAGAAGAAGAAACC
CCAACAAACTATATTCTAACCCTAATCCCAAAGATTGCCAATGTACTCTCAGAATGTGTC
GACAACTTAGACGAAGAACTCATTGTCAGTGCTTTCGAAGTCTTTGACAGTCTTATAGAC
TCAGGTCAGGACATCACAAGCAATATTGAGCTTCTTATTAGAATTGGTTTAGAAAAAGTT
GGAGCTAACTCAAAACTTCAGTTATCAACACGTGAATGCGCTTTGGACTTTTTAGAAACC
ATTGCTGATATGAAGCCAAAGATTTTAACATCTTCACCTGAGATGGTTAGGTATCTCCTT
ACAAACATATTTACTATTGCCACAGAAATTGACGATAATGGTGATGAACCAACATGTGTC
GATATGGCTATGAGGCTTTTAGATACTCTTGCTTTAACTCTTCCTAACAAAACAGTCTAC
CCTCATGTTTTTGAACTTTCCTCTCATCTTAGAGCCAATCCTCAAGCTAGAATGCGTAAA
ATTGGTGTTCTTGCCCTTGGTGTTATTGCTGAAGGATGTGCTGATTACGTCAAACAAGAT
CTGGCAAATGTTGTAAATATATTATTACAAGGACTACAAGATCCTGATGTTGCTGTTAGA
GAAGGAGCTGGATTAAGTATGGGCTACTGTGCTGAGCATTTAAAACCAGATATTCTCGAT
CTTCATTCTATAATCTTACCCCAGCTACTTAATTTACTAGACTTTAACAACATCAAAGTT
AAGCAAAAAGCTTTATATGCTATTGATATATTCTGTGAATATTTCGATGATGATATTGAA
CAGTATCTCCCTACCCTTGTGAATAAACTTATGTTTCTTACTGTTAACGAAAGTGATAGC
AAGGTTAAAGAAATGGCCGTCTCAGCATTGACCTCAGCAATATCTTCAGCCGAACTAAAA
ATCGTCCCTTACTTCCTTCCAATAGTCAGACTTTTAGGAGACATTCTCCAAGCTGCAGAT
AAAGAAATGAATCTCAAAGCTATGTCTTTGCAGTGTCTTGGAACTTTGGCTTCATCATCA
ACAATTGAATTATTTACCCCTTATATTGCTGATAGTGTTAATGTTGCTTTTGCTTTCTTG
TCTGGTGAAGTTCTTGAACAAAGAGAAGCAGGTTTTGCTTTCTTTTACTCATTATCCAAA
CTCCTTAAAGTTCAGATTGAGCCTTATGCTGACAGAATTATTGCTGAAGCTTTGAAATCT
TGTGAGGCCCAAGAAGGGACAAAAATTGAAGTTGTCAATGAGGACAATGACGATAGTGAT
GATGAAGAGGCTGAATCAGTTTATAAAGTCCGCACCGTATTCTTAGATGAGAAAACAGCA
GCATTGCATACACTTGGCAACCTTGCTATAGCATGCCCTGGGAAAGTTTTAGCCAGCATG
CAAAGAATCGAAGCCAATCTTGACGTTCTTTTCGACTATTTCCACGAGAACATCAGAATG
CAATGCGTGACAACAGCTCAACAATTAGTTGAAGGACTTTCTCAACTTCCAGGAGGCATT
CAGAATATTCATGATTACTGGTATATGAAAGTGATTCATAATTATATGGAAATGCTCGTT
GAAGATGAATCCAAAGAAGTTGTTATTAGAGTCTTAGAAGCCATTGAAGAACTACTTAAG
AAAATTGGTACAGTTTTGATACCTGATAATACTATGCCTTTACTTATTGATCAATTCGTC
GTTCTTTTAGATGAAGGTGCAGCTTGTCAAAAACAAGGTGATGAAACTGAAGGTGATCAT
GATGAGTCCCTTATGGGAGACTTTTGTGATACTCTTATGCAGATGGCTAAAGACTGGAAA
GAAGCTTTTTCAATGCACTTTGAGAAACTCCTTCCTGGAATTGAGAAATTCACAAGGTCT
GAGAGAAACATGAGAGACAGGATTTTGTTTACTGGATTATTGGCTGATACTCTAAAGCAT
ATGCCTTCAGTAGCTACTAAATATGCTATGAATTTCGCTGTACTTGTTGAAAGAAATTTA
GGTGGTGATGATGCTTCTATATACAGAAATACACTTTATTATTTAGGAGTTTTATGTGAA
GCTGCCCCAGTATTAAGTTCAGAATACAACAAATTTTTACAGCTTCTTCAGCCTTTCTTC
ACTAATACTTTTGAGCCTGCTACAGTTGACAATGCTGTTGCTGCTGTTTGCAGAATGATT
ATTACTAATCCTGCCTCTATTCCTCTTGAAAGTGTCTTGCCTGTCTTATACTCCAAACTT
CCTTTGAAAGATGACTTTGATGAGTTCAAGACTGTTATAAGGCTTATAGTGTTCTTGTAT
TCTAATCCTGGTCTTAACTTATCTGTTTATAATGAATTATCTTTGAAACTACTTATTGAA
GCTGTTATTGTAGACTCAAATGATACTGATAAGTACAAAATCGACACTGATACCAGAGAT
AAAGCCAAAGCTTTGATTCACAGTTTTAAGGGCCAGCCACTGTTAGAGAACTTGATTGCC
GCACTTGCCCCTGAAAGCCAAAACGTCTTAATTAAGATTTTATAG