Identifiers and Description

Gene Model Identifier

SteCoe_5770

Standard Name

None

Aliases

None

Description

FKBP_C domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_005481301.6218080426054863e-71peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein
Oxytricha TrifallaxContig19730.0.g301.9006199352650016e-55Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD

WormBaseWBGene000008773.975449735908647e-31
Saccharomyces CerevisiaeYLR216C1.603810890548638e-28Peptidyl-prolyl cis-trans isom
erase (cyclophilin); catalyzes
the cis-trans isomerization o
f peptide bonds N-terminal to
proline residues; plays a role
in determining prion variants
; binds to Hsp82p and contribu
tes to chaperone activity; pro
tein abundance increases in re
sponse to DNA replication stre
ss

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_5770(Protein)
MDISGDGGLLKEILQEGTGETPSTGEEVEVHYTGSLLDGSKFDSSLDRGEPFKFTLGEGK
VIKGWDQGVATMKVGEKCILTCREDYAYGKKGMPPKIPASATLKFEVELLARHEKVKEKW
EFEYHERVEKAKMLKDQGNELVKQGKFAQARKECYAEGLSWIEEDPTDEVDINETSRELR
MTKVQLYSNLAICDIKAENWSEAINNCNEALKLDPNNIKILFRRGTARLNFGLLDEALKD
VQSGLDLEPNNKDFKQLQAKIKDRAKKEKQEEKKMFGNIFGKSGGLYSEKKVAISEYAIP
SSPISTNPKVFMDITIGDRQAKRVTFELFANIVPKTAENFRALCTGEKGVGRAGVPLSFK
GCTFHRVIKGFMMQGGDFTNHNGTGGESIYGLKFEDENFSIKHKQSGLLSMANSGPGTNG
SQFFITFVETPHLDGKHVVFGRVLDGMEACLEVENTEVDKGDKPKAVVRIVECGMVNN


>SteCoe_5770(CDS)
ATGGACATTTCAGGTGACGGAGGATTACTCAAAGAAATTCTTCAAGAAGGTACAGGAGAA
ACTCCTTCAACTGGAGAAGAAGTTGAAGTCCACTACACAGGATCTTTGCTCGACGGGTCA
AAATTTGACTCTTCACTAGACCGTGGGGAGCCTTTCAAATTTACCCTAGGGGAAGGAAAA
GTGATTAAAGGTTGGGATCAGGGTGTTGCCACAATGAAAGTTGGAGAAAAATGCATTTTA
ACTTGTAGGGAAGATTATGCTTATGGGAAAAAAGGTATGCCTCCTAAAATCCCAGCTAGT
GCAACGTTGAAATTTGAAGTTGAGCTCTTGGCAAGACATGAAAAAGTAAAAGAAAAATGG
GAATTTGAGTATCATGAAAGAGTAGAAAAAGCTAAAATGTTGAAAGACCAAGGAAATGAA
CTGGTTAAACAAGGGAAATTTGCCCAGGCGAGGAAGGAATGTTATGCTGAAGGACTATCA
TGGATTGAAGAAGACCCTACTGATGAAGTAGATATTAATGAAACTTCAAGAGAATTAAGA
ATGACTAAGGTTCAGTTGTATTCGAATCTAGCGATATGCGATATTAAAGCTGAGAACTGG
TCAGAAGCTATTAACAATTGTAATGAAGCTTTGAAACTTGACCCGAATAATATTAAAATA
CTCTTCCGTAGAGGAACAGCTAGGCTAAACTTCGGCCTTCTTGACGAAGCTCTTAAAGAC
GTGCAAAGCGGTTTAGACCTTGAACCTAACAACAAAGACTTCAAGCAACTTCAAGCCAAA
ATCAAAGACAGAGCGAAAAAAGAAAAGCAAGAAGAAAAAAAGATGTTTGGGAATATCTTT
GGCAAAAGCGGTGGTCTGTACTCTGAGAAAAAAGTTGCAATCAGTGAATATGCAATTCCT
TCAAGTCCTATATCAACAAATCCAAAAGTATTCATGGATATTACAATAGGTGATAGACAA
GCTAAACGAGTAACTTTTGAACTTTTTGCTAATATTGTGCCAAAAACCGCAGAGAATTTC
CGAGCTTTATGTACTGGAGAAAAAGGTGTTGGTAGAGCTGGAGTACCTTTATCATTTAAA
GGATGTACTTTTCATAGAGTGATTAAAGGGTTTATGATGCAAGGTGGGGATTTTACTAAT
CATAATGGTACTGGTGGGGAAAGTATATATGGATTGAAGTTTGAAGATGAGAATTTTTCT
ATAAAACATAAACAGTCAGGGTTGTTGTCTATGGCTAATAGTGGACCTGGGACTAATGGG
TCACAGTTTTTTATAACTTTTGTTGAAACTCCGCATTTAGATGGAAAACATGTTGTGTTT
GGGAGAGTTCTTGATGGAATGGAAGCTTGTTTAGAAGTGGAGAATACAGAAGTGGATAAG
GGTGATAAACCAAAAGCTGTTGTGAGGATTGTGGAATGTGGGATGGTCAATAATTAG