Identifiers and Description

Gene Model Identifier

SteCoe_5849

Standard Name

None

Aliases

None

Description

DEAD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003166803.917469664450395e-64DEAD/DEAH box helicase family
protein
Oxytricha TrifallaxContig240.1.g1372.820770088460135e-53DEAD/DEAH box helicase

Saccharomyces CerevisiaeYFL002C2.506567475899953e-46Putative ATP-dependent RNA hel
icase; nucleolar protein requi
red for synthesis of 60S ribos
omal subunits at a late step i
n the pathway; sediments with
66S pre-ribosomes in sucrose g
radients
WormBaseWBGene000139831.1089390193121365e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_5849(Protein)
MDWENIGIDSDLARAVRENFGFKSPTPVQKAGIPHFIGNKDICVESCTGSGKTLTFLLPI
FHKLIKSGFPKCVFALIISPSRELANQTYEVAEKLSKNFPLASLQCLIGGHSREDDIFQM
ATFDKNIVIGTPGRIADLLEAGDVNFKEVEILILDEADRLLDMGFKEKITWIIESLPRQR
RTGLFSATMTTDVQSLIKAGLRNPIYINVKVTKNDTNHSQALPKGLTNYYSIFPTYLEKL
PALARFLYKNPDKKVIVFFATCASTNFYLYVLERLEKLGNLKFFRLHGKMKQSQREKIYK
EFSEAPCAVLLTTDLIARGIDFPDINWIVQFDPPQNPDFFVHRIGRTARANREGDSMLFL
TKHEETYINYLTMKNIEFSNIKLKRFKILDKLKDIVLEDREGYEKAQAAFVAYVRYYKEH
NLNYIFQFKHLELGFLAQGFCLLRLPRVSEILGKNIENFEQSEINPDDIAYKDPQKEERR
QKLLIEKEEMIARKKEIKIKALRDKKGQNKRKRSRSEKRDAKKQSMVEDFDELGREESII
SKIRKGKMNSEEVKSYIAENPHIKTLFRKKKH


>SteCoe_5849(CDS)
ATGGATTGGGAAAACATAGGCATAGACTCCGACCTAGCCCGTGCAGTCAGAGAAAACTTC
GGGTTTAAATCTCCGACTCCAGTACAAAAAGCTGGTATTCCTCATTTCATAGGAAACAAA
GACATTTGTGTGGAGTCCTGTACAGGATCAGGAAAGACTCTAACCTTTTTATTACCAATC
TTCCATAAACTCATAAAAAGTGGCTTTCCAAAATGTGTATTTGCCCTTATTATATCCCCT
TCAAGAGAATTAGCAAATCAAACATATGAAGTCGCTGAAAAATTGTCAAAAAATTTCCCT
TTAGCAAGTCTTCAATGTTTAATTGGAGGACATTCTAGAGAAGATGATATTTTCCAAATG
GCTACTTTTGATAAAAATATAGTCATAGGAACTCCAGGGAGAATTGCAGATTTGTTAGAA
GCTGGAGATGTGAATTTTAAAGAAGTTGAAATATTGATTCTAGATGAAGCTGATAGATTA
TTAGATATGGGTTTTAAAGAGAAAATCACGTGGATTATAGAAAGTTTACCTAGACAAAGG
AGGACTGGGTTGTTTTCAGCGACTATGACAACTGATGTGCAAAGTTTGATAAAAGCAGGA
CTAAGAAATCCTATATATATCAATGTAAAAGTGACTAAAAATGACACAAATCACTCTCAA
GCTTTACCTAAAGGTTTGACAAATTATTACTCAATATTCCCGACGTATTTAGAAAAACTA
CCAGCATTAGCGAGATTTCTATATAAAAACCCAGACAAAAAGGTTATTGTATTTTTCGCA
ACTTGTGCAAGCACAAACTTTTACTTGTATGTTTTAGAACGATTAGAAAAACTTGGAAAC
TTGAAATTTTTCAGGCTTCATGGGAAAATGAAACAAAGCCAAAGAGAAAAAATATACAAA
GAATTTTCTGAAGCACCTTGCGCTGTGTTGTTAACTACTGATCTTATTGCTAGGGGGATT
GATTTTCCTGATATCAATTGGATAGTCCAATTCGACCCACCACAAAACCCTGATTTTTTT
GTCCATAGAATCGGGAGGACAGCAAGGGCTAATAGAGAAGGAGATTCAATGCTATTTTTA
ACTAAACATGAAGAAACTTATATAAATTACCTTACAATGAAGAATATCGAATTTAGTAAT
ATCAAACTAAAAAGGTTTAAGATTCTAGATAAACTTAAAGACATTGTTCTTGAAGATAGA
GAAGGATATGAAAAAGCTCAAGCAGCGTTCGTAGCTTATGTTAGGTATTATAAAGAGCAC
AATTTGAATTATATCTTTCAATTCAAACATCTGGAGTTAGGGTTTTTGGCACAAGGTTTT
TGCTTATTGAGGCTTCCAAGAGTTTCTGAAATTCTTGGGAAGAATATTGAGAATTTCGAA
CAATCAGAAATAAACCCTGATGATATTGCTTATAAAGATCCACAAAAAGAAGAAAGGAGG
CAGAAATTACTTATAGAAAAAGAGGAAATGATTGCTAGGAAAAAAGAGATTAAGATAAAG
GCGCTTAGAGATAAGAAAGGGCAAAATAAGAGGAAAAGAAGTAGGAGTGAGAAAAGAGAT
GCTAAAAAACAGTCGATGGTAGAAGATTTTGATGAACTTGGTAGAGAAGAAAGCATTATA
AGTAAAATTAGAAAAGGGAAGATGAATAGTGAGGAAGTAAAAAGTTATATTGCTGAAAAC
CCACACATAAAAACTTTGTTTAGAAAGAAAAAACATTAA