Identifiers and Description

Gene Model Identifier

SteCoe_5876

Standard Name

None

Aliases

None

Description

V-ATPase_C domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • hydrogen ion transmembrane transporter activity (IEA) | GO:0015078

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12845.0.g808.75651076269652e-27V-ATPase subunit C

WormBaseWBGene000069208.75651076269652e-27
Saccharomyces CerevisiaeYKL080W5.74952226429356e-19Subunit C of the V1 peripheral
membrane domain of V-ATPase;
part of the electrogenic proto
n pump found throughout the en
domembrane system; required fo
r the V1 domain to assemble on
to the vacuolar membrane; the
V1 peripheral membrane domain
of vacuolar H+-ATPase (V-ATPas
e) has eight subunits
Tetrahymena ThermophilaTTHERM_001053204.248354255291589e-18hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_5876(Protein)
MEHWLISFRCKSSERAQLWDSLRNEVLTNSLCTTSTFNIDQQFKSGSLDSLVALADDLSK
LDHQLEATIRKIERQYTDLEPNPKLTISISNRGNSQDLAPSTYLSDFHWDISKYPPSKSL
SEISTMIDERLKKLDEDIKKESTEFIEMRNSVSQITKRESGGLLNRDLNDILVPSICNAE
DFFNTEYLKTLLVVVPKKEVEQWLATYEQLSQRVVPQSTKQFNIEEKDGNTLWRVVILKI
GESEFLVNAKKNRWVVREFEFNPEKNMEEKKMNDKQKVSFSNKQKVLIELCKSVFSELFI
ALTHLKAIRIYIESILRYSLPPQYFSIIVTPKDGQQKRILNGLVNKFLMPGERPNMFCSK
EESEDGEDYFPFVFLRMPKY


>SteCoe_5876(CDS)
ATGGAACACTGGCTTATATCATTTCGGTGCAAAAGCTCAGAACGTGCTCAGTTATGGGAT
TCACTGAGAAACGAAGTCCTCACTAATAGCCTCTGCACAACGAGCACTTTTAACATTGAC
CAACAGTTCAAATCAGGCTCATTAGATTCTTTAGTAGCTCTAGCTGATGATTTATCTAAA
CTAGACCATCAACTAGAAGCTACAATTCGGAAAATCGAGAGACAATACACTGATCTTGAA
CCAAACCCCAAGCTGACAATCAGTATTTCCAACCGTGGGAATAGCCAGGACTTAGCTCCA
TCCACCTATCTCTCTGACTTCCACTGGGACATATCCAAATACCCACCTTCCAAATCTCTA
TCAGAAATCTCCACAATGATCGACGAAAGGTTAAAAAAACTAGATGAAGACATCAAAAAA
GAAAGCACTGAATTCATTGAAATGAGAAATTCTGTCTCACAAATAACAAAAAGGGAATCT
GGAGGACTTTTAAATAGAGACTTAAATGACATCCTTGTTCCTAGTATTTGTAATGCTGAA
GATTTTTTCAATACAGAATACTTAAAAACTTTACTAGTTGTTGTCCCTAAGAAAGAAGTA
GAACAATGGCTTGCAACATATGAACAATTAAGCCAAAGGGTTGTCCCACAGAGTACTAAA
CAGTTTAATATTGAAGAAAAAGATGGGAATACTCTATGGCGTGTTGTGATATTGAAGATA
GGAGAAAGTGAATTTCTTGTCAATGCTAAGAAAAATCGATGGGTTGTGAGGGAGTTTGAG
TTTAATCCAGAGAAAAATATGGAGGAAAAAAAGATGAATGATAAGCAAAAAGTGAGTTTT
AGTAATAAACAGAAGGTGTTGATTGAGTTGTGCAAGAGTGTTTTTAGTGAATTGTTTATT
GCCTTAACCCATTTGAAAGCGATTAGGATATATATTGAATCGATACTTAGGTATTCGTTA
CCTCCTCAGTATTTTAGTATTATTGTTACCCCGAAGGATGGACAGCAGAAACGTATTTTG
AATGGACTTGTTAACAAGTTTTTGATGCCTGGGGAAAGACCGAATATGTTTTGCTCTAAA
GAAGAGAGTGAAGATGGAGAGGATTACTTCCCTTTTGTCTTTTTGAGAATGCCCAAGTAT
TAG