Identifiers and Description

Gene Model Identifier

SteCoe_5962

Standard Name

None

Aliases

None

Description

Tctex-1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004858000.00000000000009357622968840175Light chain subunit of ciliary
three-headed outer arm dynein
(OAD), two-headed inner arm d
ynein (IAD) complex 1, and non
-axonemal dynein complex 1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_5962(Protein)
MTEYIFLLFAILELTIYGYNNMQHESFAVLKEDVATAVNKLVNSFLSNKEYNQDEVQNWT
ASLSEDIVKTLKTMSTNFKFCVSCVILQKGDAGMHISTTCYWDSNVDGSVAIKCENNSMY
CIVNIFGVSF


>SteCoe_5962(CDS)
ATGACTGAGTATATATTTTTACTTTTTGCCATATTAGAATTGACGATATATGGCTATAAT
AATATGCAGCACGAGTCCTTCGCGGTGTTGAAAGAAGATGTTGCCACTGCTGTTAATAAG
TTAGTTAACAGTTTTCTGAGTAATAAGGAATACAACCAAGACGAAGTACAAAATTGGACT
GCTTCGCTGTCTGAAGATATTGTCAAGACCCTTAAGACTATGAGCACAAACTTCAAATTT
TGTGTGTCGTGTGTCATCTTACAGAAAGGAGATGCAGGCATGCATATAAGCACAACTTGC
TATTGGGATAGCAATGTCGATGGAAGTGTTGCCATTAAGTGTGAAAACAACTCTATGTAC
TGCATAGTGAATATCTTTGGCGTCTCATTTTAG