Identifiers and Description

Gene Model Identifier

SteCoe_6069

Standard Name

None

Aliases

None

Description

Abhydrolase_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig15605.0.g907.781132241133797e-20Partial alpha/beta-hydrolase l
ipase region

Tetrahymena ThermophilaTTHERM_001129402.1151310375910805e-19ab-hydrolase associated lipase
region family protein; Steryl
ester hydrolase, similar to y
east TGL1, YEH1 and YEH2 stery
l ester hydrolases
WormBaseWBGene000097736.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_6069(Protein)
MKAIGKALIAFPLFYGSYQYYMLSKRQVPKEATMTFQEYCEYKGLSVQSHLVTTQDGYNL
TLFRVSKGKEPDKNKTPVIMVHGLTHSSISFVIAQNSTPPAVRLIDEGYDVWLLNTRGNY
YSRTHQTLDPKSKEYWQWCSNHIGQYDIPASIDYVLKGTGKKRINYIGHSQGGFVGLYCL
TMLPKYGEKVNVMVVWAPPGGGKIAAKSQYLADIFKESFLQDLESKGINFIADWSPIPND
SAVYAYTFPYLAAWKYKDKYDVSLEKEDASVLSIYLQQFSGGTSVMNLRYLQQLIQRNAP
IAYMFDYGKDENIKKYGQEIPPIIHYANIRAKIAVMYGKHDDVCTMDNGENLAALLPKRW
LIFKKFDYDVDHAGFAVSPNQKHMDDVLKIFKEHELQ


>SteCoe_6069(CDS)
ATGAAAGCCATTGGTAAAGCTCTTATAGCATTTCCTTTATTCTATGGGTCATACCAATAC
TATATGCTATCAAAAAGGCAGGTGCCAAAAGAAGCGACAATGACATTTCAAGAGTATTGT
GAATACAAAGGTCTTTCAGTACAGTCACATCTAGTGACAACACAAGATGGCTACAATCTA
ACATTATTCCGTGTATCAAAAGGTAAGGAGCCAGATAAGAATAAAACCCCAGTCATTATG
GTCCATGGACTAACCCATAGTTCAATATCTTTTGTCATAGCCCAGAATTCAACACCTCCA
GCTGTAAGACTTATAGATGAAGGTTATGATGTTTGGCTTCTAAATACAAGAGGAAATTAT
TATAGTAGAACTCATCAAACATTAGATCCAAAAAGTAAAGAATATTGGCAATGGTGTTCT
AATCATATAGGTCAATATGATATCCCAGCATCAATAGACTATGTTTTAAAAGGTACAGGA
AAAAAAAGAATTAATTATATCGGGCATTCACAAGGGGGATTTGTTGGTCTTTATTGTCTT
ACTATGCTTCCAAAATATGGAGAAAAGGTCAATGTTATGGTGGTTTGGGCACCACCTGGA
GGAGGTAAAATAGCTGCAAAATCACAGTACTTGGCTGATATTTTTAAAGAAAGTTTTTTG
CAGGACCTTGAAAGTAAAGGAATTAATTTTATAGCTGATTGGAGTCCTATACCAAATGAT
TCTGCTGTTTATGCTTATACTTTCCCATATTTGGCTGCATGGAAATATAAAGATAAATAT
GATGTTTCACTTGAAAAAGAAGATGCTTCAGTATTGTCAATTTATTTACAACAGTTTTCA
GGAGGCACTTCGGTTATGAATTTGCGATATTTACAACAGTTGATTCAGAGAAATGCACCA
ATCGCTTATATGTTTGACTATGGTAAAGATGAAAATATTAAGAAATATGGTCAAGAAATA
CCTCCGATTATACATTATGCTAATATTAGAGCGAAAATTGCGGTTATGTATGGGAAACAT
GATGATGTATGTACGATGGATAATGGAGAGAATTTAGCAGCTTTATTGCCGAAAAGATGG
CTGATTTTCAAGAAGTTTGACTATGATGTTGATCATGCAGGATTTGCAGTCTCACCAAAT
CAGAAACATATGGATGATGTATTGAAGATATTTAAAGAACATGAATTACAGTAA