Identifiers and Description

Gene Model Identifier

SteCoe_6177

Standard Name

None

Aliases

None

Description

Ras domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000042696.639677199580735e-36
Tetrahymena ThermophilaTTHERM_004677601.3336148155022614e-34Rab VI family protein; small m
onomeric GTPase that regulates
membrane fusion and fission e
vents
Saccharomyces CerevisiaeYLR262C3.6251409191435593e-34Rab family GTPase; Ras-like GT
P binding protein involved in
the secretory pathway, require
d for fusion of endosome-deriv
ed vesicles with the late Golg
i, maturation of the vacuolar
carboxypeptidase Y; resides te
mporarily at the Golgi, dissoc
iates into cytosol upon arriva
l of the Rab GTPaseYpt32p, whi
ch also functions in the late
Golgi; Golgi-localized form is
bound to GTP, while cytosolic
form is GDP-bound; homolog of
the mammalian Rab6
Oxytricha TrifallaxContig5831.0.g61.462486227251231e-31Ras family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_6177(Protein)
MEGIQGSISSQVKKYKIVFLGDLSVGKTSIINQFMYGTFDPVHQPTIGIDFLSKTMYLDD
RTIRLQLWDTAGQERFRSLIPGYIRDCSMAVVVFDITQKQSFLSIDKWIEDVRNERGGDV
VIMVAANKSDLADRRTVSTEEIEKKSKELNVKILEVSAKTGNNVKLLFRNLAQDLPGMED
VSLANNAEFAGEGFKLQNAQQTEKKKQEDCKC


>SteCoe_6177(CDS)
ATGGAAGGCATTCAAGGGAGCATTTCAAGCCAGGTTAAAAAATATAAAATCGTATTCCTC
GGGGACTTGAGTGTAGGAAAAACTTCAATCATCAACCAGTTCATGTATGGAACCTTCGAC
CCTGTCCATCAGCCAACAATCGGCATAGACTTCCTTTCAAAAACCATGTATCTTGATGAC
CGGACTATAAGACTACAATTATGGGATACAGCTGGTCAAGAAAGATTTAGATCACTTATT
CCTGGATATATAAGAGATTGTTCAATGGCTGTTGTAGTTTTTGATATTACTCAGAAACAG
AGCTTTTTGAGTATAGATAAATGGATTGAAGATGTGAGAAATGAAAGAGGTGGAGATGTT
GTTATTATGGTCGCTGCTAATAAAAGCGATCTTGCAGATAGGAGAACTGTTAGTACTGAG
GAAATAGAAAAGAAATCTAAAGAATTGAATGTTAAAATACTTGAAGTTAGTGCGAAAACA
GGGAATAATGTTAAATTATTGTTTAGGAATCTTGCTCAGGATTTACCTGGTATGGAAGAT
GTGTCTTTAGCGAATAATGCTGAGTTTGCCGGTGAAGGGTTTAAGTTGCAAAATGCCCAG
CAGACTGAGAAAAAGAAACAAGAGGACTGCAAATGCTAA