Identifiers and Description

Gene Model Identifier

SteCoe_6250

Standard Name

None

Aliases

None

Description

ERK7 subfamily kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig194.1.g740Protein kinase domain

WormBaseWBGene000154781.4411565509640892e-64
Saccharomyces CerevisiaeYGR040W6.054601895401186e-39Mitogen-activated protein kina
se (MAPK); involved in signal
transduction pathways that con
trol filamentous growth and ph
eromone response; the KSS1 gen
e is nonfunctional in S288C st
rains and functional in W303 s
trains

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_6250(Protein)
MSEDIETHILRKYEILQKLGKGAYGIVWKAIDKKTREVIALKKVFDAFQNATDAQRTFRE
IMFLQELNGHENIIRLLNVIRAENDRDIYLVFDFMETDLHAVIRANILEEIHKQYVTYQI
LKALKYMHTGQLLHRDLKPSNILLNSECLVKVADFGLARSVASQEEGSNAVLTDYVATRW
YRAPEILLGSTKYSKAVDMWSLGCIIGEMLHGKPIFPGTSTLNQLDRILELTGRPSAEDI
ESIQSNLASTMLDSLPPGRAKTYHDFFPSASDDALDLVRKLLQFNPSKRLTIEQCLRHPY
VAQFHNPDDEPACNRTITISINDDKKFSIREYRDRIYTDISKKKKEIRRRHLQARGYYH


>SteCoe_6250(CDS)
ATGAGTGAAGATATTGAAACCCACATACTGAGAAAGTACGAAATTCTGCAAAAACTCGGT
AAGGGTGCTTATGGAATAGTTTGGAAAGCAATCGACAAAAAAACCCGTGAAGTGATAGCT
TTGAAAAAAGTCTTTGACGCTTTTCAAAATGCAACTGATGCGCAAAGGACATTCAGAGAG
ATTATGTTCTTACAAGAACTTAATGGCCACGAAAACATCATCCGTTTACTCAACGTAATC
AGAGCAGAAAACGACAGGGATATATACCTCGTTTTTGACTTTATGGAAACTGATCTTCAT
GCAGTGATCCGGGCTAACATACTAGAAGAAATCCATAAGCAATACGTAACTTATCAAATC
CTCAAAGCTTTAAAATACATGCACACAGGACAATTGCTTCATCGAGATTTAAAACCATCA
AATATTCTTCTTAATTCTGAATGCTTGGTTAAAGTTGCTGATTTTGGACTTGCCCGTTCT
GTAGCATCTCAAGAAGAAGGTTCTAATGCAGTTCTCACAGACTATGTTGCAACTCGTTGG
TATAGAGCTCCTGAGATTTTATTAGGGTCAACAAAATACTCAAAAGCTGTAGATATGTGG
AGTCTTGGGTGTATAATTGGGGAAATGCTTCATGGCAAGCCAATTTTCCCTGGGACATCA
ACACTTAATCAATTAGACAGGATACTTGAATTAACAGGAAGACCTTCAGCTGAAGATATT
GAGTCTATTCAGAGCAACTTAGCCTCAACTATGCTTGATAGTTTACCTCCAGGAAGGGCA
AAAACTTACCATGATTTTTTCCCTTCAGCTAGTGATGACGCTTTGGATTTGGTTAGAAAA
CTTCTTCAGTTTAACCCAAGCAAAAGATTAACAATAGAACAATGCTTAAGACATCCTTAT
GTTGCTCAGTTCCATAACCCTGATGATGAACCTGCTTGCAATCGTACAATAACTATTTCT
ATAAACGATGATAAGAAATTTTCTATCCGCGAATACCGTGATAGAATCTATACAGATATA
TCAAAGAAAAAAAAGGAAATCCGTAGAAGACATCTACAAGCTCGTGGGTACTATCACTAA