Identifiers and Description

Gene Model Identifier

SteCoe_6336

Standard Name

None

Aliases

None

Description

MMR_HSR1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004556501.0112214926104486e-43nuclear ribosome-associated GT
Pase
Oxytricha TrifallaxContig22056.0.g491.5007857627073948e-4150S ribosome-binding GTPase

WormBaseWBGene000038216.639677199580735e-36
Saccharomyces CerevisiaeYER006W3.532628572200807e-24GTPase that associates with nu
clear 60S pre-ribosomes; requi
red for export of 60S ribosoma
l subunits from the nucleus

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_6336(Protein)
MKDHKGHKGHTKDQKKHKRSSKKDFHVKKTLKKDPGLPNLTSIKNDMVSELCRKKPTNDR
KSQIQKLLKKNPKSFEEYISHATSANLSYNAPSSISSNNYMDSSRKSYFKELLKVIESAD
IILEVLDARDPQGYRCQEIENKVLSYGNKRLIVVLNKIDLIPGNIATAWYNLITANFPCV
LFRSNTQEQNNHLSSASFYKTSMGTSFSQSMLDGNKALGIEALMGIIKNYMRSGDIKKAV
TVGVVGYPNVGKSSVINSLRRSKAVGVSSTPGFTKCIQEVEIESNIKILDCPGIVFDTSF
DPDMVLRNVVKIDMVDDFLRPVQRILEKVSRQKMLEIYGIEEFSDVSNFLGNLARKRGKL
KKGGIADLDAAGKIVLNDWVAGKIEYYVPPPDMMTE


>SteCoe_6336(CDS)
ATGAAAGATCACAAAGGGCACAAAGGACACACGAAGGACCAAAAAAAGCACAAAAGAAGC
AGCAAAAAAGACTTCCATGTGAAAAAAACTCTAAAAAAAGATCCTGGCCTACCCAACCTG
ACCTCAATTAAAAACGATATGGTCTCAGAACTCTGCAGAAAAAAGCCAACCAATGACCGA
AAGTCCCAAATCCAAAAACTCCTTAAAAAAAACCCTAAATCTTTCGAAGAGTATATTTCC
CATGCAACTTCTGCTAATTTATCTTACAATGCGCCTTCTAGCATTTCTTCTAACAATTAC
ATGGACTCATCACGAAAGTCCTATTTCAAAGAGCTCTTAAAAGTGATCGAATCAGCTGAC
ATAATCCTAGAAGTCCTTGATGCGAGAGATCCACAAGGCTACAGATGCCAAGAAATTGAA
AACAAAGTCTTATCCTATGGTAACAAACGCTTAATAGTCGTTCTTAACAAAATCGACCTC
ATCCCAGGAAATATAGCAACAGCTTGGTACAACCTAATAACAGCTAATTTCCCATGTGTT
CTTTTTAGATCTAACACCCAAGAACAAAACAATCATCTTTCCTCAGCATCATTTTACAAA
ACTTCTATGGGTACATCATTTAGCCAAAGTATGCTTGATGGTAACAAAGCACTTGGAATT
GAAGCTTTAATGGGTATTATAAAAAACTATATGAGAAGTGGGGATATCAAAAAAGCTGTT
ACAGTTGGTGTTGTTGGATATCCAAATGTTGGTAAAAGTAGTGTTATTAACTCATTAAGA
AGGTCTAAAGCAGTAGGGGTTTCAAGTACACCTGGATTTACTAAATGTATACAAGAAGTT
GAAATTGAAAGCAATATTAAGATTTTAGACTGTCCTGGGATAGTTTTTGACACAAGTTTT
GACCCTGATATGGTTTTGAGAAATGTTGTGAAAATTGATATGGTTGATGATTTTTTAAGA
CCTGTGCAGAGGATATTGGAAAAAGTGTCAAGGCAGAAAATGCTTGAGATATATGGGATT
GAGGAATTTAGTGATGTTAGTAACTTTTTAGGGAATTTAGCTAGGAAAAGAGGGAAACTG
AAGAAAGGGGGAATTGCAGATTTAGATGCTGCGGGGAAAATTGTTTTGAATGACTGGGTT
GCTGGGAAGATTGAGTATTATGTCCCCCCACCGGATATGATGACTGAATAA