Identifiers and Description

Gene Model Identifier

SteCoe_6427

Standard Name

None

Aliases

None

Description

tRNA-synt_1g domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig1085.1.g650tRNA synthetases class I (M)

WormBaseWBGene000034150

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_6427(Protein)
MKLVYESAKEPAKACLLALQYTGIPAKKQIEPVPVVTLELGDQDKTGNFIELMGELSITR
YLMKQCSWQVPDNLHLDEWVLYHLKPIVSNTPKSQVKSNQDLLSSIGYLEQQISEQFICG
QKPGSTDILSFTYLYQYFSGNPWMVKTFPKLANSYKQISEVYNVVQEELGEKVKVPAKVG
KAVEEFAPYATILRDKNVEKVPVEGKRNILITSALPYVNNVPHLGNIIGCVLSADVFSRY
CRLRGYNSIYICGTDEYGTATETKAIQEGLTPQEICTKYHEIHKKIYDWFDIDFDYFGRT
TTNQQTEIAQNIFLKLKENGELNEDNVEQSFCEPCNRFLADRFILGTCPSCNYLDARGDQ
CDKCGKLLNPEELIDAKCFLCSSSPKMRISKHIFLNLPNIRERLENWVSKSSSDGRWSAN
CLKITSAWIRDGLKPRCITRDLKWGTPVPLPEFSEKVFYVWFDAPIGYISITANYTSQWE
KWWKNTNNVELIQFMGKDNIPFHTVIFPSSLLGTGENWTLLSNISSTEYLNYEDGKFSKS
RGVGVFGDNIIETNIPVEIFRYYLLSNRPETSDTVFKWTDLAEKNNNELLPNLGNLFNRL
LKYLAKSNKPIPNASTITEFDENTLENIYILVKRYLDEMEELKLKNALKTAMEVSALGNK
YFQDTEFWTLEKKDVERFKTVINLAANVARLVALLLEPFMPSFSAKVYNQFGIQRDAREE
SLLEVLAASTSSRVILTLLKEGTKVGNVMPIFRIITPEQVNTFKARYAGKKDN


>SteCoe_6427(CDS)
ATGAAATTAGTCTACGAGTCAGCCAAAGAACCAGCAAAAGCTTGTCTCCTCGCTCTTCAA
TATACAGGAATCCCTGCAAAAAAACAAATTGAGCCAGTACCTGTCGTAACATTAGAGTTA
GGAGACCAAGACAAAACAGGTAATTTCATAGAGTTAATGGGTGAGCTTAGCATAACAAGA
TATCTAATGAAACAATGTTCATGGCAAGTTCCAGACAATCTTCACTTAGACGAATGGGTT
CTTTATCATTTAAAACCAATTGTCAGCAATACACCAAAATCTCAAGTAAAATCAAATCAA
GACCTTTTATCATCAATAGGATATTTAGAACAACAGATTTCAGAACAGTTTATTTGTGGT
CAAAAACCAGGGTCAACTGATATTTTGAGTTTTACTTATTTGTATCAGTACTTCTCAGGA
AATCCATGGATGGTAAAAACTTTTCCAAAACTTGCTAATAGTTATAAGCAAATAAGTGAA
GTTTATAATGTTGTGCAAGAAGAATTAGGAGAAAAAGTAAAAGTTCCTGCTAAAGTTGGC
AAGGCTGTTGAAGAATTTGCCCCATATGCTACTATTTTAAGAGATAAGAATGTGGAAAAA
GTTCCGGTTGAAGGGAAGAGAAATATACTTATAACAAGCGCTTTACCTTATGTTAATAAT
GTCCCTCATTTAGGAAATATTATTGGTTGTGTGTTGAGTGCTGATGTATTTTCAAGATAC
TGTCGACTTCGTGGATATAACTCAATTTATATCTGTGGTACTGATGAATATGGTACAGCT
ACTGAGACAAAAGCTATACAAGAAGGTCTAACTCCTCAGGAAATCTGCACAAAATATCAT
GAAATTCATAAAAAAATATATGATTGGTTTGATATTGATTTTGACTATTTTGGTAGGACG
ACAACTAATCAACAAACTGAAATCGCCCAAAATATTTTCTTAAAACTTAAAGAAAACGGA
GAACTTAATGAAGATAATGTTGAACAGAGTTTTTGTGAGCCTTGCAATAGGTTTTTAGCT
GATAGGTTTATTTTAGGAACTTGTCCTAGTTGTAATTATTTAGATGCAAGAGGTGATCAA
TGTGATAAATGTGGTAAACTTCTTAACCCTGAAGAACTTATAGATGCTAAGTGTTTTTTG
TGTAGTTCTTCTCCTAAAATGAGAATCTCTAAACACATTTTCCTCAACTTGCCAAATATA
AGGGAAAGACTTGAAAATTGGGTTAGTAAAAGCTCAAGTGATGGCAGATGGAGTGCAAAT
TGTTTGAAAATCACGTCAGCTTGGATTAGAGATGGGCTTAAGCCAAGGTGTATTACTCGT
GATCTTAAATGGGGGACTCCAGTGCCATTGCCTGAATTCTCTGAAAAAGTGTTTTACGTC
TGGTTTGACGCTCCAATTGGTTATATTTCAATAACAGCAAATTACACAAGCCAATGGGAA
AAATGGTGGAAAAATACCAACAACGTTGAACTTATTCAGTTTATGGGTAAAGACAATATC
CCATTCCATACAGTAATATTCCCATCATCACTTCTAGGCACAGGGGAGAATTGGACTTTA
CTTAGCAACATAAGTTCAACCGAGTATCTCAACTACGAAGACGGCAAATTCTCAAAATCT
CGTGGAGTTGGGGTTTTTGGCGACAATATCATCGAAACCAACATCCCAGTAGAAATCTTC
AGATACTATTTATTAAGCAATAGACCTGAAACTTCAGATACTGTTTTCAAATGGACTGAT
TTAGCTGAAAAAAACAACAATGAACTTTTACCAAATCTTGGAAATCTTTTCAATAGACTT
CTTAAATATCTAGCAAAAAGCAATAAACCTATACCAAATGCTAGCACAATTACAGAATTT
GATGAAAATACACTTGAAAATATATACATTCTTGTTAAAAGATATTTAGATGAAATGGAA
GAACTCAAATTAAAAAATGCACTTAAAACTGCTATGGAAGTTTCAGCTCTTGGTAATAAG
TATTTCCAAGATACTGAGTTTTGGACTTTAGAGAAAAAAGATGTGGAAAGATTTAAGACT
GTGATTAATTTGGCTGCTAATGTGGCAAGACTTGTAGCTTTACTTCTTGAACCTTTTATG
CCATCATTTTCTGCTAAGGTTTATAATCAGTTTGGTATTCAAAGAGACGCTAGAGAAGAA
AGTTTATTAGAAGTTCTTGCGGCATCTACAAGTTCTAGAGTTATATTGACTTTATTGAAA
GAAGGGACTAAAGTTGGAAATGTTATGCCGATATTTAGGATTATAACTCCAGAACAAGTT
AATACTTTTAAAGCTAGATATGCAGGGAAAAAAGATAATTAG