Identifiers and Description

Gene Model Identifier

SteCoe_6441

Standard Name

None

Aliases

None

Description

Skp1_POZ domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004263203.975449735908647e-31Skp1 homolog; gene depletion i
nduced telomere elongation; af
finity purification enriched f
or SCF ubiquitin ligase compon
ents
Oxytricha TrifallaxContig10669.0.3.g171.0806392777072785e-30Skp1 family, dimerisation doma
in

WormBaseWBGene000048071.0530617357553812e-20
Saccharomyces CerevisiaeYDR328C2.1151310375910805e-19Evolutionarily conserved kinet
ochore protein; part of multip
le protein complexes, includin
g the SCF ubiquitin ligase com
plex, the CBF3 complex that bi
nds centromeric DNA, and the R
AVE complex that regulates ass
embly of the V-ATPase; protein
abundance increases in respon
se to DNA replication stress

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_6441(Protein)
MAEVKLKLVSSEGTTYEVEETVACKSQLIKNMVEDAGTAEEIPLPNVKSEILEKVIEYCR
HYRDSSPQEIEKPLKSAMLSEVVPAWDANFVELEQEALFELILAANYLDIKSLLDLTCAK
VASMLKGKTAEEIRRQFNIENDFTPEEEAQVREENKWAELE


>SteCoe_6441(CDS)
ATGGCTGAAGTGAAACTTAAACTCGTATCATCTGAAGGGACAACCTACGAAGTTGAAGAA
ACTGTTGCATGTAAGTCTCAGTTAATCAAGAATATGGTTGAAGATGCAGGAACAGCTGAA
GAAATCCCACTTCCAAATGTCAAGTCAGAAATCCTTGAAAAGGTTATAGAATATTGTAGA
CATTATAGAGATAGTTCTCCTCAAGAGATAGAAAAGCCTTTAAAATCAGCTATGCTTAGT
GAAGTTGTACCAGCTTGGGATGCTAATTTTGTTGAACTTGAACAAGAAGCTTTATTTGAA
CTTATTCTCGCTGCTAATTATTTGGATATTAAGTCTTTACTTGATCTTACATGTGCCAAA
GTAGCTTCAATGCTTAAAGGAAAAACCGCGGAAGAGATTAGAAGACAATTCAATATTGAA
AATGATTTCACACCTGAAGAAGAGGCTCAAGTAAGAGAAGAAAATAAATGGGCTGAACTT
GAGTAG