Identifiers and Description

Gene Model Identifier

SteCoe_6613

Standard Name

None

Aliases

None

Description

ABC_tran domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig14340.0.g910ABC transporter

Saccharomyces CerevisiaeYFR009W1.3485799642996046e-77Positive regulator of the Gcn2
p kinase activity; forms a com
plex with Gcn1p; proposed to s
timulate Gcn2p activation by a
n uncharged tRNA
WormBaseWBGene000183394.834541638053336e-68

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_6613(Protein)
MEGKVEDVIRRVSSNLSLPERCFSYMAGMILDDPPRNSTELHDMLEDFFTDGGCKKDTQK
LAGDIWKQLLEIGFKSSEKVDRIVAEQMKTGVILNETGISTEAITADYVDPFLGIQKAIV
NFNSQDKGVKNIKARRTAEEQQKHALTMKAFQRTYPPARVFHTKSEGKTRDIIVERFSMQ
IGGKNLLENASLKVAFPRKYGLVGRNGIGKTTLLSALAAGDIEKVPKNLHILYVEQEITG
DDNTALQTLLEADVEREELLKLQTQIQNDVIKMAEISERLQMIDAFTAESRAAGILSGLG
FTNETMRFETKKLSGGWRMRIALAKGLFCQPDILLLDEPTNHLDLETVVWLEDYIHTYPN
TVIVVSHDRAFLNNVATDIIHFHSESLHYFRGNYDDFERVRGEKLLCQRRAHDAQQARID
HVQKFIDRFRYNAKRASMVQSRIKSLNKMEIIDEVLEDPTCVFQFPDMEKLSAPLLRIDD
GSFGYGSETILSEININIDMDTRMAIVGRNGCGKTTLLKLLEEYIPLKTGQLYKHRRLRI
ATFTQHHIDLLDLSLSPLEQLALMYPNTPSEAIRAHLGSFGITGNLALRPICFLSGGQKS
RVAFSAVAFKQPHILFLDEPTNHLDIDAVNALIIAVEAFSGGVLVVSHDQHFVSSVCKEI
WVIKKGRVRKFKGEFNDYRKLISSS


>SteCoe_6613(CDS)
ATGGAAGGAAAAGTTGAGGACGTAATCCGCAGGGTTTCCTCAAATCTCAGTCTTCCAGAA
CGATGCTTCTCCTACATGGCAGGGATGATCCTAGACGATCCTCCTCGCAACAGTACCGAG
TTGCACGACATGTTAGAAGATTTTTTCACAGACGGCGGGTGTAAAAAAGATACCCAAAAA
CTAGCAGGGGATATATGGAAGCAACTTCTAGAAATCGGCTTCAAAAGTAGTGAAAAAGTT
GATAGAATCGTAGCCGAGCAAATGAAAACAGGAGTAATACTAAATGAAACTGGGATATCA
ACAGAAGCTATTACAGCTGATTATGTTGATCCATTTTTAGGTATCCAAAAAGCTATAGTA
AACTTTAATTCTCAAGATAAAGGGGTTAAAAATATAAAAGCAAGGAGAACTGCTGAGGAA
CAACAAAAACATGCTTTGACAATGAAAGCTTTTCAAAGAACATATCCTCCTGCAAGGGTT
TTTCATACAAAATCAGAAGGTAAAACTAGGGATATTATTGTAGAGAGGTTTTCTATGCAA
ATTGGTGGGAAGAATTTGTTAGAAAATGCAAGTCTTAAAGTAGCTTTTCCAAGGAAATAT
GGCTTGGTTGGGAGGAATGGGATTGGGAAAACTACATTATTAAGTGCTTTAGCCGCTGGG
GATATTGAGAAAGTGCCGAAAAATCTGCATATTTTGTATGTGGAACAAGAAATAACAGGA
GATGACAACACAGCATTACAAACTTTGTTAGAAGCAGATGTTGAAAGAGAAGAATTGCTT
AAACTTCAAACCCAAATCCAAAACGACGTCATAAAAATGGCAGAAATCAGTGAAAGGCTA
CAAATGATCGACGCTTTCACTGCAGAAAGTCGTGCGGCAGGGATTTTAAGTGGTCTTGGT
TTTACAAATGAAACCATGCGTTTTGAAACAAAAAAACTCTCAGGTGGTTGGAGAATGAGA
ATCGCTTTAGCAAAAGGTCTTTTTTGTCAACCAGATATACTTCTTCTTGATGAACCTACA
AACCATTTAGATCTTGAAACTGTTGTATGGCTAGAAGATTATATTCATACATATCCAAAT
ACAGTAATTGTTGTTTCACATGATAGAGCATTTTTAAACAATGTTGCTACTGATATTATT
CATTTCCATTCAGAATCCCTTCATTATTTTAGAGGAAATTATGATGATTTCGAAAGAGTC
CGTGGGGAAAAACTCTTATGTCAAAGACGTGCTCACGATGCTCAACAAGCAAGAATCGAC
CATGTGCAGAAATTTATCGACCGTTTTCGTTACAATGCAAAAAGAGCTTCAATGGTCCAA
TCACGTATAAAGTCTTTGAATAAAATGGAAATTATTGATGAAGTATTAGAAGACCCAACT
TGTGTTTTTCAATTCCCTGATATGGAAAAACTTAGCGCACCACTTTTAAGAATTGATGAT
GGAAGCTTTGGGTATGGGTCTGAAACAATATTATCAGAAATCAATATTAATATTGACATG
GATACTAGAATGGCTATTGTAGGAAGAAATGGTTGTGGTAAAACAACATTACTTAAACTA
TTAGAAGAATATATACCTTTGAAAACAGGACAATTATATAAACACAGAAGGCTGAGGATC
GCAACTTTTACTCAGCATCATATTGATTTATTAGATTTATCACTTTCTCCACTTGAACAA
TTAGCATTAATGTACCCAAATACCCCTTCTGAAGCTATAAGAGCCCATTTAGGATCTTTT
GGTATCACTGGAAACTTAGCTTTAAGACCTATTTGCTTTTTATCTGGTGGCCAAAAGTCT
AGAGTTGCCTTTTCTGCTGTTGCTTTTAAACAACCTCATATACTCTTTTTAGATGAACCA
ACAAATCATTTAGATATCGATGCTGTAAATGCACTTATTATTGCTGTTGAAGCTTTTAGT
GGAGGTGTTCTTGTTGTTAGCCATGATCAACATTTCGTTAGTTCAGTTTGTAAAGAAATA
TGGGTTATTAAAAAAGGACGTGTGAGGAAGTTCAAAGGTGAATTCAATGATTATAGAAAA
TTGATAAGCTCTAGTTAA