Identifiers and Description

Gene Model Identifier

SteCoe_6661

Standard Name

None

Aliases

None

Description

Spt5-NGN domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig17111.0.g191.185064864233981e-27Early transcription elongation
factor of RNA pol II, NGN sec
tion

WormBaseWBGene000050152.3802664086944007e-26
Saccharomyces CerevisiaeYML010W1.5628821893349888e-18Component of the universally c
onserved Spt4/5 complex (DSIF
complex); the complex has mult
iple roles in concert with RNA
polymerases I and II, includi
ng regulation of transcription
elongation, RNA processing, q
uality control, and transcript
ion-coupled DNA repair

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_6661(Protein)
MSSYEESEDENYSEGSLPKKRTKRQSKKKKASKKRFSKSQFLDIQAESGDEEESSVDSEF
RDEKDEAEHMLQKLRKRESVLDTMDPDAIARKYDERVKLSMQSLPKEISHIAKQRELPSI
EDPKLWQVGCRKGKGKEAVINLLQKAIHKQSENDPLKIFSAFASSHVKDYVYIEAYSKID
VIYAVRGMHMLNEMRINLVPNDEMVEVFSMDKAKKVNLKKGTFVRIRSGDYKGDLAQVVA
VEEHRGRAMIRVVPRLEKTGNKKIRAPAKLFNHDDYRDAEKKRDSSEQGLFYYCWNGMQF
YSGFLHKYMSLRSLQISNVNPSLGEFQIFQTTHNDDNEENVPTIQGRKIQFIQGDKVKVI
KGDVKGLTGTVHTSSDGVVFIIPHVEDLCESKYEFPVEDLCKFFEDGDHVKVIAGRYAGI
TGMIISTSDNSAEILCDVSKNVITALCNDLKLSDEVSSGLSITSDYRIYDIVTLINDNAF
GIVVKVDSEFVTTILTSGETRNVWFHEISKKFIPKRVSALDRDQNSLMEGDMVKISFSRS
PYYNKCGAIKNSLRGVLFINVLGEGEFGIVPIKANYCLLLGTESKPLEQGEARKSDVVGK
MVRIKTGPYRGYTGKVTELNNSKARIEMSTLSKYFTVDIEACEILKSGEEVISIQKPDVT
RTPAAVHSPGYEISTPAQDFSTPWDTPHGDHYFAKSPSATRNYRN


>SteCoe_6661(CDS)
ATGTCAAGCTACGAGGAGTCAGAAGACGAGAATTACTCAGAAGGCTCATTGCCTAAAAAG
AGGACAAAGCGGCAGTCTAAGAAAAAGAAAGCATCCAAAAAGCGATTCTCAAAGAGTCAA
TTCTTGGATATCCAGGCTGAAAGTGGAGATGAGGAAGAGTCTAGTGTTGACTCTGAGTTC
CGTGATGAAAAAGACGAAGCTGAGCATATGTTGCAGAAACTTAGAAAAAGAGAGTCGGTA
CTAGATACAATGGACCCTGATGCTATAGCTAGGAAGTATGATGAACGAGTTAAGCTCTCT
ATGCAAAGCTTACCTAAAGAAATCAGCCATATAGCAAAACAAAGGGAATTACCATCAATT
GAAGACCCGAAACTTTGGCAAGTCGGTTGTAGGAAAGGAAAAGGTAAAGAAGCGGTGATA
AATTTACTTCAGAAAGCTATTCATAAGCAATCAGAAAATGACCCATTGAAAATTTTTTCT
GCTTTTGCTAGTAGTCATGTAAAAGATTATGTTTATATTGAAGCATATTCGAAAATTGAT
GTTATTTATGCTGTTAGAGGAATGCATATGCTTAATGAAATGAGGATAAATTTAGTGCCA
AATGATGAAATGGTTGAAGTGTTTTCTATGGATAAAGCTAAAAAGGTTAATTTGAAAAAA
GGGACTTTTGTTAGAATACGTTCTGGGGATTATAAAGGAGATTTAGCTCAAGTTGTTGCT
GTAGAGGAACATAGAGGAAGGGCTATGATAAGAGTTGTACCAAGACTAGAGAAAACAGGG
AATAAAAAAATAAGAGCTCCTGCAAAACTGTTTAATCATGATGACTATAGAGATGCTGAG
AAAAAAAGAGATAGTTCAGAACAAGGGCTTTTTTATTATTGTTGGAATGGGATGCAATTT
TATTCTGGGTTCCTTCATAAGTACATGTCTTTAAGAAGTTTACAGATTTCTAATGTTAAT
CCATCATTGGGTGAGTTTCAGATTTTCCAAACTACACATAATGATGATAATGAAGAAAAT
GTTCCTACTATACAAGGAAGGAAAATACAGTTTATTCAAGGAGATAAAGTTAAGGTTATT
AAAGGAGATGTTAAAGGACTTACAGGTACAGTGCACACATCAAGTGATGGAGTAGTTTTT
ATCATTCCACATGTTGAAGATTTATGTGAAAGTAAATATGAGTTTCCAGTTGAAGACCTT
TGCAAGTTTTTTGAAGATGGGGATCATGTTAAAGTCATTGCTGGTAGGTATGCTGGAATA
ACTGGGATGATTATCTCAACATCAGATAACTCTGCTGAAATTCTTTGTGATGTAAGCAAA
AATGTTATAACTGCCTTGTGCAATGACTTAAAGCTAAGTGATGAAGTAAGCTCAGGACTT
TCGATAACAAGTGACTATAGAATCTATGATATAGTAACCTTAATCAATGATAATGCTTTC
GGAATTGTCGTCAAAGTTGATAGTGAGTTTGTCACGACCATCCTTACAAGTGGAGAAACA
AGGAATGTTTGGTTTCACGAAATAAGTAAAAAGTTTATCCCGAAGCGAGTATCAGCTTTA
GACCGTGACCAAAACTCTTTAATGGAAGGGGATATGGTAAAAATCAGTTTTAGCCGTAGC
CCATATTACAACAAATGTGGGGCAATAAAAAACTCTTTACGTGGTGTACTTTTTATAAAC
GTCTTAGGTGAAGGGGAATTCGGTATAGTCCCAATAAAAGCTAATTATTGTCTTTTACTA
GGCACAGAATCAAAACCTTTAGAACAAGGTGAAGCTAGAAAATCAGATGTTGTTGGGAAA
ATGGTAAGAATTAAAACTGGTCCATATAGAGGTTATACAGGGAAAGTTACTGAACTTAAT
AATAGTAAGGCAAGAATTGAAATGAGTACTCTAAGTAAATATTTCACTGTAGATATCGAA
GCTTGTGAGATACTCAAATCAGGAGAAGAAGTTATTAGTATACAAAAACCAGATGTGACA
AGAACTCCTGCTGCAGTACATTCTCCTGGATATGAAATCAGCACACCAGCTCAAGATTTC
TCAACGCCATGGGATACTCCACATGGGGATCATTATTTTGCAAAGTCTCCAAGTGCAACT
AGAAATTATAGGAATTAA