Identifiers and Description

Gene Model Identifier

SteCoe_6667

Standard Name

None

Aliases

None

Description

PFK domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_001703202.6395702969591894e-66Alpha subunit of heterooctamer
ic phosphofructokinase
Oxytricha TrifallaxContig14330.0.g573.1743585474772134e-60Phosphofructokinase

WormBaseWBGene000221990.00000004139937718785167

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_6667(Protein)
MFTFLTRKSPLGLIRAIGTYDIIEHKAIISDQSIGLLPPKLLTGTSNEIYINPMLGNGYK
NDVNSGQGFIPEAIFSKLGGYINANSAFSNDFLQGKSAYLVKGYPRKQIIMNPQKVKACI
VTCGGLCPGLNVVIRELYMTLHYNYGVPEIYGIRDGYKGFYTPGCLQEFNTSTVHDIHLK
GGTILRTSRGGWDKDKISNSIINNGFNQIYIIGGDGTHRGIASLVNELSSKGHFASVVGV
TKTIDNDIPIIDRSFGFDTSVEEAQKAIDSADIEANSIENGVGLVKLMGRNSGFIALHSS
IANRNVNLCLIPESDYELEGPNGVYAYIANRLKVKSHAVIVVAEGAATGCKDQDLRNTGK
DASGNLALYDIGKHLKDGIAKYCKNQGIDVTLKYIDPTYMIRSIPANSTDKKLCTMLAQA
AVHGAFAGFTGFSVGLVANQIAYLPVDLMTKIYEGKNASPGQRKVDVDNNMMWWKLMSST
GQPSFRNLV


>SteCoe_6667(CDS)
ATGTTCACATTTTTAACAAGAAAAAGTCCTTTAGGTTTGATAAGAGCGATAGGAACTTAT
GATATTATAGAGCACAAAGCGATAATATCAGATCAAAGTATAGGTCTTTTACCTCCAAAA
CTCTTAACAGGAACTTCTAATGAGATTTATATTAACCCAATGCTTGGGAATGGGTATAAA
AATGATGTGAATTCAGGACAAGGGTTTATACCTGAGGCTATATTCTCAAAGCTAGGTGGT
TATATCAACGCAAATTCAGCATTTTCTAATGATTTCCTACAAGGGAAATCTGCATATTTA
GTCAAAGGTTACCCACGTAAACAAATAATCATGAACCCACAAAAAGTCAAAGCTTGTATC
GTAACATGTGGGGGTCTCTGTCCAGGTCTTAATGTTGTAATTCGTGAACTCTACATGACC
CTTCACTATAATTATGGTGTCCCTGAAATCTATGGTATTCGCGATGGATATAAAGGTTTT
TACACCCCAGGATGTTTACAAGAATTTAATACATCTACAGTTCATGATATTCATCTTAAA
GGTGGGACTATTTTACGTACATCACGTGGGGGTTGGGATAAAGATAAAATCTCAAATTCC
ATAATAAACAATGGGTTCAATCAAATCTATATAATAGGAGGTGATGGTACTCATAGAGGA
ATCGCTTCTTTAGTAAATGAATTATCAAGTAAAGGGCATTTTGCATCTGTAGTTGGGGTT
ACTAAAACTATAGATAATGATATCCCTATTATAGATAGATCTTTTGGCTTTGATACCTCA
GTTGAAGAAGCACAAAAGGCAATAGACTCTGCTGATATTGAAGCTAATAGTATTGAAAAT
GGTGTTGGGCTAGTAAAACTTATGGGTCGAAATAGTGGGTTTATAGCTTTACATTCATCA
ATTGCTAATAGAAATGTTAATCTATGTTTAATCCCTGAAAGTGATTATGAACTTGAAGGA
CCTAATGGAGTTTATGCTTATATTGCTAATAGGCTTAAAGTTAAAAGTCATGCTGTTATA
GTTGTAGCTGAAGGGGCTGCAACAGGTTGTAAAGACCAAGATTTAAGAAATACTGGAAAA
GATGCTTCAGGGAATTTAGCTTTATATGATATTGGGAAACACCTTAAAGATGGAATTGCT
AAATATTGTAAAAATCAAGGTATTGATGTAACACTTAAATATATTGACCCTACTTATATG
ATAAGAAGTATTCCTGCGAATTCTACTGATAAGAAATTGTGCACAATGCTAGCTCAAGCT
GCTGTTCATGGAGCTTTTGCTGGATTTACAGGGTTTTCAGTTGGTCTTGTAGCTAATCAA
ATCGCATATTTACCTGTGGATTTGATGACGAAAATTTATGAAGGGAAAAATGCTAGTCCT
GGACAAAGGAAAGTTGATGTTGATAATAATATGATGTGGTGGAAACTTATGTCATCTACT
GGGCAGCCTAGTTTTAGAAATTTAGTTTAA