Identifiers and Description

Gene Model Identifier

SteCoe_674

Standard Name

None

Aliases

None

Description

ANAPC8 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • regulation of mitotic metaphase/anaphase transition (IEA) | GO:0030071

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007364701.9503933001302485e-65Anaphase promoting complex sub
unit 8 / cdc23 family protein
Oxytricha TrifallaxContig18641.0.g694.2960271311739114e-61Tetratricopeptide repeat

Saccharomyces CerevisiaeYHR166C5.380186160021138e-32Subunit of the Anaphase-Promot
ing Complex/Cyclosome (APC/C);
APC/C is a ubiquitin-protein
ligase required for degradatio
n of anaphase inhibitors, incl
uding mitotic cyclins, during
the metaphase/anaphase transit
ion
WormBaseWBGene000031343.221340285992516e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_674(Protein)
MEASPFNKITEPAILISNLEEARQELRYAVSLLSSYKLYQSSKWAAQLLISIPIQASPKS
PYQDSLDSSYDNLQLAKTLFDLKEYIKAASVLTEYSKPNFPQAYFLYHYSMYMYGEFRRE
EESIEEGKEMENRQLFSIDSQLKPIDPMCAYLLGVVKKHRGETDAAKELLVKSLNDFPIN
WSAWLELVDLCDNDCLAKIKNHWMKNFFIAQFYHKMQKTEESIDLYALVAEKYFPSSSFI
YSQIGNEFFLMDDYTNAIIWFEQVEEVDPYSYELMDVYSNILYVREESGKLSYLAYRMFQ
NDKYRPETCFVLGNYYSLKNDHTRAMVYFKRATELDKNYLPAWILMGHEYLEMQNVTKAI
ESYRTAIELDPKDYRAWYGLAETYEVSDMNLYAIYYYYKAILTRPQDSRLWVALGTCYEK
MGKTSDSTKCYEKAERLKDREGVVLHRLARLYGRLGLTEKAAKCFLESLSRKDMENDTGE
ETVEAIMFLKQYYLSKNMSEEAATYARRLYDFGGAELDRATYHIRQTELN


>SteCoe_674(CDS)
ATGGAAGCAAGTCCTTTTAACAAAATCACAGAGCCCGCAATTTTAATAAGTAACCTTGAA
GAAGCAAGACAAGAGCTAAGGTACGCAGTATCCTTACTAAGTTCATACAAGCTTTACCAA
AGTTCAAAGTGGGCTGCCCAGTTACTCATAAGTATCCCAATCCAAGCTTCTCCAAAATCT
CCTTATCAAGATTCACTAGACTCTTCATACGACAATCTTCAACTAGCAAAAACTTTATTT
GATCTAAAAGAATACATAAAAGCAGCATCAGTTCTCACAGAATATTCAAAGCCAAATTTC
CCTCAAGCATATTTCTTATATCATTACTCAATGTATATGTATGGGGAATTCCGAAGAGAA
GAAGAAAGTATTGAAGAAGGTAAAGAAATGGAAAATCGACAGCTTTTTAGTATTGATTCA
CAACTTAAACCAATTGACCCTATGTGCGCATATTTATTAGGTGTGGTGAAAAAACATAGA
GGTGAGACTGATGCTGCTAAAGAACTTCTTGTAAAAAGTTTGAATGATTTTCCTATAAAC
TGGTCAGCTTGGTTAGAACTTGTAGATTTATGTGATAATGATTGTTTGGCTAAAATAAAA
AACCATTGGATGAAGAATTTTTTTATAGCACAATTCTATCATAAAATGCAGAAAACTGAA
GAAAGTATTGATTTGTATGCACTTGTTGCTGAAAAATATTTCCCAAGTAGCTCGTTTATA
TATTCACAAATTGGAAATGAGTTCTTTCTTATGGATGATTATACAAATGCTATTATATGG
TTTGAACAGGTTGAAGAAGTTGATCCATATAGTTATGAGCTTATGGATGTGTATTCTAAT
ATTTTATATGTCCGAGAAGAATCAGGGAAACTTAGCTATTTGGCTTATCGGATGTTTCAA
AATGATAAATACAGGCCTGAAACCTGTTTTGTCTTGGGTAATTATTATAGTTTAAAAAAT
GATCATACAAGAGCTATGGTTTATTTTAAACGAGCGACTGAGTTAGATAAAAACTATTTG
CCTGCTTGGATTTTGATGGGCCATGAGTATTTAGAAATGCAAAATGTTACTAAAGCTATT
GAGTCTTATAGGACTGCTATTGAACTTGATCCTAAAGATTATAGAGCTTGGTATGGACTT
GCTGAAACTTATGAAGTTAGTGATATGAACCTTTATGCTATTTACTATTATTATAAAGCT
ATTTTAACTAGACCTCAAGATTCACGTTTATGGGTTGCTTTAGGGACTTGTTATGAGAAA
ATGGGTAAAACAAGTGATTCGACAAAATGTTATGAAAAAGCTGAAAGGCTTAAAGATAGG
GAAGGTGTTGTTTTGCATAGATTAGCAAGATTATATGGGAGACTTGGGCTGACTGAAAAA
GCAGCGAAATGCTTTTTGGAAAGTTTATCAAGAAAAGATATGGAAAATGATACAGGGGAA
GAAACAGTTGAAGCGATTATGTTTTTGAAACAGTATTATCTTTCTAAAAACATGAGTGAG
GAAGCGGCAACTTATGCTAGGAGACTTTATGATTTTGGTGGAGCTGAATTGGATAGAGCA
ACTTATCATATAAGACAAACAGAACTTAATTAG