Identifiers and Description

Gene Model Identifier

SteCoe_687

Standard Name

None

Aliases

None

Description

ArgoL1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig1484.1.g650Piwi domain

Tetrahymena ThermophilaTTHERM_011610407.175095973164411e-66PAZ/Piwi Domain protein simila
r to Piwi/Argonaute; required
for accumulation of scnRNAs, e
limination of IES and chromoso
me breakage during macronuclea
r development; interacts with
scnRNAs; involved in histone H
3 lysine 9/27 methylations
WormBaseWBGene000041787.47197233734299e-43

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_687(Protein)
MQSLQLARRPGYCESGQGIPISANFFSFQLSTGGDKIQKYAVNFEPAIADSLGKQRERVL
NKVKGQLIEHIGKYVFATTALYSAQTSTQVTLISNFDNTDYTITVTPTGPVESDLEIKAF
YNKFFNSVQGRLNLVMIGRKFFNPDRPVELPQHKLAIWPGYASSVGTYENGCLINIDISH
RCLRTITVYDQIAEIRSKNPSDFRNAVAKYFIGAIILTLYNKKNYKVDDIDWDMSPNSTF
ADKNGQQSSFKAYYGSKWGKNIVHDDQPLLRCKTKQIEALLVPEFCVMTGLTDEIRADFN
IMKDMAQATKKEPHMRLEESAGLIKAIKSNEKANIEVVNWKADISIQPVTLTGRVIAAGS
IMMGGNANFKINDQTGSFDRDIQNTMYSQPNLDKWGVFFCENDRKLVESSFMTTLNQVIS
TYKVQCQKPVLFGVKSDRWNDWEQILRSNLNPSIKMIVCILPGSRGKSRLYDDLKRMIFS
SLPVPSQCILNATLKKDKGLRSVVNKVIMQINAKIGGVPWALQNLPFSDAPTMAVGIDVF
HKAGSHSVLGFCATTDKNFAKYVSLPKVNAPSEEICSQLSECMVQAITQFAIENGRPPAR
IVIFRDGVSDSQRSAVLEGEIPQIKQAFSKLRGDGKLPEDPKLIFLVVNKRINARFYANQ
GGKVNNPPLGTIVDRAVVEKNGYDFYVMPAKATQGAMTPTHFHVIYDDTGIRCDEVQQLA
YRMCYSYYNWSGSIRVPAPCQYAHKLAYQYGERANNSGPPIPHTHWGTTRCLYFL


>SteCoe_687(CDS)
ATGCAAAGTCTTCAGTTAGCAAGGAGACCTGGTTACTGTGAAAGTGGCCAGGGTATTCCA
ATCAGCGCAAATTTTTTCTCATTCCAACTTTCAACAGGTGGCGACAAAATTCAAAAATAT
GCTGTGAATTTCGAACCTGCGATAGCTGACAGCTTAGGTAAACAGCGAGAAAGAGTTCTA
AACAAAGTTAAAGGCCAACTAATTGAACATATTGGTAAATACGTCTTTGCTACAACAGCT
TTATATAGTGCTCAAACATCAACACAAGTGACTCTAATTAGTAATTTTGATAACACAGAC
TACACAATCACAGTCACTCCAACTGGGCCTGTAGAAAGTGACCTTGAAATCAAAGCTTTT
TATAACAAGTTTTTCAATAGCGTCCAAGGCAGACTGAATCTAGTCATGATTGGGAGAAAA
TTCTTCAACCCAGATCGACCTGTTGAGCTCCCACAACACAAACTTGCAATATGGCCAGGG
TATGCAAGTTCTGTTGGGACATACGAAAATGGTTGTCTTATCAACATTGACATTTCCCAT
AGATGCCTAAGAACTATAACAGTTTATGATCAAATCGCTGAAATACGTAGTAAAAATCCT
TCAGATTTCAGAAATGCTGTGGCGAAATACTTTATCGGGGCTATTATCCTTACACTTTAT
AATAAAAAAAATTACAAAGTTGATGATATTGATTGGGATATGAGTCCTAATAGCACTTTT
GCTGATAAAAATGGTCAACAAAGTAGTTTTAAAGCTTATTATGGGTCTAAATGGGGGAAG
AATATTGTACATGATGATCAGCCTTTATTAAGATGTAAAACAAAGCAAATTGAAGCTTTA
TTGGTTCCTGAGTTTTGTGTTATGACTGGGCTTACTGATGAAATTCGTGCTGATTTTAAT
ATTATGAAGGATATGGCTCAAGCTACTAAAAAGGAACCTCATATGAGACTTGAAGAATCT
GCTGGGTTGATTAAAGCTATTAAAAGTAATGAAAAAGCTAATATTGAAGTTGTTAATTGG
AAAGCTGATATTTCGATTCAGCCTGTTACGTTAACTGGTAGGGTAATTGCTGCTGGGAGT
ATTATGATGGGGGGTAATGCGAATTTTAAAATCAATGACCAGACTGGGAGTTTTGATAGG
GATATACAGAACACTATGTATTCACAGCCGAATCTTGATAAATGGGGAGTGTTCTTTTGT
GAAAATGATAGAAAACTTGTGGAATCGTCGTTTATGACAACACTGAATCAAGTCATTTCC
ACTTATAAAGTACAATGCCAAAAACCTGTACTTTTTGGGGTAAAATCTGATCGTTGGAAT
GACTGGGAACAAATCCTTAGGTCTAATTTAAACCCATCAATAAAAATGATTGTTTGTATA
CTTCCTGGATCCCGAGGTAAATCTCGTCTATACGATGATCTTAAAAGGATGATTTTCTCC
TCTCTCCCTGTTCCTTCACAATGCATCCTCAATGCAACATTAAAAAAAGACAAAGGCTTA
CGTTCTGTTGTCAATAAAGTTATCATGCAAATCAATGCAAAAATCGGTGGAGTCCCTTGG
GCACTTCAAAACCTTCCATTCTCAGATGCCCCAACAATGGCAGTTGGTATAGACGTATTC
CACAAAGCAGGAAGTCATAGTGTTTTAGGATTTTGTGCAACAACAGATAAAAATTTTGCA
AAATATGTTTCATTACCTAAAGTTAATGCCCCAAGTGAAGAAATCTGCTCACAACTTAGT
GAATGTATGGTTCAAGCTATAACACAATTTGCTATAGAAAATGGAAGACCACCTGCAAGA
ATAGTAATTTTCCGAGATGGAGTTTCAGATAGTCAAAGGTCAGCAGTACTTGAAGGAGAA
ATTCCTCAAATCAAACAAGCATTTTCAAAGCTTAGAGGTGATGGTAAACTTCCTGAAGAT
CCAAAGCTTATATTCCTTGTAGTAAATAAAAGAATCAATGCTAGGTTTTATGCAAATCAA
GGAGGGAAAGTTAATAACCCACCTCTTGGGACTATTGTTGATAGAGCAGTTGTTGAGAAA
AATGGTTATGATTTTTATGTTATGCCTGCTAAAGCTACACAAGGTGCTATGACACCTACA
CATTTTCATGTGATTTATGATGATACTGGAATTAGATGTGATGAAGTTCAACAACTTGCT
TATAGGATGTGCTATTCTTATTATAATTGGAGTGGGTCTATTAGAGTTCCAGCACCTTGT
CAATATGCACATAAATTAGCGTATCAGTATGGAGAAAGAGCTAATAATAGTGGCCCACCT
ATTCCACATACACATTGGGGTACTACTAGATGCCTTTATTTTTTGTAA