Identifiers and Description

Gene Model Identifier

SteCoe_6931

Standard Name

None

Aliases

None

Description

Toprim domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000129950
Oxytricha TrifallaxContig18848.0.g1061.0927656633766312e-73DNA topoisomerase

Saccharomyces CerevisiaeYLR234W1.6458114310822737e-38DNA Topoisomerase III; conserv
ed protein that functions in a
complex with Sgs1p and Rmi1p
to relax single-stranded negat
ively-supercoiled DNA preferen
tially; DNA catenation/decaten
ation activity stimulated by R
PA and Sgs1p-Top2p-Rmi1p; invo
lved in telomere stability and
regulation of mitotic recombi
nation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_6931(Protein)
MSRVLMVAEKPSIAKSISEALGRNFTQKRGISKVCSIYEFQGTFFNEPATFIVTSVCGHL
YSTDFPRQYNNWDSIDPLELYDVDTIKVETPSKGGSIVKHLQQEAHGCSYLVLWLDCDRE
GENICFEVIDIVKPILRKTQYEQIYRAKFSSLTPTDLRNAMSCLIAPNKNEALSVDARQI
LDLKVGCSFTRFQTKFFQGKYGNLDSKLISYGPCQTPTLGFCVKRHDEILSFKPEPYYTL
VLVSKTQPSVRFHHIRGHIKHEPTAQGLYQKLLPHKNSTATVLSVDKSKHKSKKPQGLNT
VQLLKLGSTHLGISPHTTMNIAEHLYLNGFVTYPRTESTAYAPSFDLMSVVNTLSRVDDL
AEHCNLLKNGGFKKPHKGIDAGDHPPITPCSSDGYKSLGKMESSLFFLISKYFLATVSKD
AEFEKVNVRICLDGEEFTAEGSRSINPGFSAMTPWLCGKEKDMPSLTVGDKIPVSNIEMN
MDYTSPPSHLTESELLGLMEHNGIGTDASMSVHINNICERNYVKVESASRRLVPTQLGVT
LVHGYYLVDKDLVLPKVRSEIEKNVSLIAKGTADFQSIVDYSLNIFKAKFKFYVEQITTV
DQLFEAIFSPIAQSSGKMMSRCGKCYRFMNYLALRPSRLYCPNCELTYKLPQNGNIRQYK
EQKCPVDGFELIQFKTERISYVLCPACYNDPPFEGSRPGLTCMNCPQYDCPNNFYKNPVA
GCPKCENDMLLTDLNKPNWKISCIECHYAENVFGGAKNVEVTEDFCEECGAAILKAKYDD
KEVVECVFCSGVAGGINERPESSRGERGGRGGRGGRGGYRGRGGHKGRGGRGRGGRRGRG
RGRGRGGYGKGTDDRMTFDGF


>SteCoe_6931(CDS)
ATGTCCCGCGTCCTAATGGTGGCCGAGAAGCCAAGTATAGCGAAATCAATCTCCGAAGCT
CTGGGTCGGAATTTCACACAAAAAAGAGGTATTTCTAAAGTCTGCTCAATCTATGAATTC
CAAGGAACATTTTTCAATGAGCCAGCAACTTTTATAGTCACTTCAGTGTGTGGTCATCTA
TACTCAACTGACTTCCCTCGTCAATACAACAATTGGGATAGCATTGATCCATTAGAACTC
TATGATGTTGATACAATCAAAGTAGAAACTCCAAGTAAAGGTGGAAGTATAGTCAAACAC
CTTCAACAAGAAGCTCATGGATGTTCATATTTAGTCCTTTGGCTTGATTGTGATCGTGAA
GGAGAAAATATTTGCTTTGAAGTTATAGACATAGTAAAGCCAATACTCCGTAAAACTCAA
TACGAACAGATTTACAGGGCGAAATTTTCATCTTTAACTCCAACAGATTTGAGAAATGCA
ATGTCATGCTTAATAGCCCCTAATAAAAATGAAGCATTATCAGTTGATGCAAGGCAAATT
TTGGATCTGAAAGTTGGGTGTAGCTTCACAAGGTTCCAGACGAAGTTTTTCCAAGGGAAA
TATGGGAATTTAGATTCAAAACTCATAAGCTATGGGCCTTGTCAAACACCTACTCTTGGG
TTTTGTGTTAAACGTCATGATGAAATCCTTTCTTTTAAGCCAGAGCCTTATTATACTTTA
GTTTTAGTATCCAAAACCCAACCTTCAGTACGTTTTCATCATATAAGAGGACATATAAAA
CATGAACCTACAGCTCAAGGCCTTTATCAAAAACTTTTACCTCATAAAAACTCAACAGCA
ACAGTTTTATCAGTAGATAAATCAAAACATAAATCTAAAAAACCTCAAGGGTTAAATACT
GTTCAATTATTAAAACTTGGTTCAACACATCTTGGTATAAGCCCACATACTACAATGAAT
ATAGCTGAACATCTTTATCTTAATGGTTTTGTCACTTATCCTCGTACAGAAAGTACAGCT
TATGCTCCATCATTTGATTTAATGTCTGTTGTTAATACATTGAGTAGAGTTGATGATTTA
GCTGAACATTGTAATTTGCTTAAAAATGGTGGATTTAAAAAACCTCATAAAGGTATTGAT
GCTGGAGATCATCCACCTATAACCCCATGTTCTAGTGATGGGTATAAATCACTTGGGAAA
ATGGAATCTTCATTGTTTTTCTTGATTTCTAAATACTTTTTGGCTACGGTTAGTAAAGAT
GCGGAATTTGAAAAGGTTAATGTTAGGATTTGTTTAGATGGGGAAGAATTTACTGCTGAA
GGGTCGAGGAGTATAAACCCTGGGTTTTCTGCTATGACTCCTTGGCTTTGTGGTAAAGAA
AAAGATATGCCAAGTTTAACTGTTGGGGATAAAATACCTGTGTCTAATATTGAGATGAAT
ATGGATTATACTTCACCACCAAGTCATTTGACTGAAAGTGAATTATTAGGTCTTATGGAA
CATAATGGTATTGGAACTGATGCATCTATGTCAGTACATATAAATAATATATGTGAAAGA
AATTATGTTAAAGTAGAAAGTGCTTCAAGACGTCTTGTACCTACCCAATTAGGTGTAACT
TTAGTTCATGGTTATTATCTTGTTGATAAAGACTTAGTTTTACCCAAAGTCCGTTCAGAA
ATCGAAAAAAATGTGAGTCTAATTGCCAAAGGTACCGCGGATTTCCAAAGTATTGTTGAT
TATTCTTTAAATATATTCAAAGCGAAATTCAAGTTTTATGTCGAACAAATCACTACAGTC
GATCAACTTTTCGAAGCTATTTTCTCCCCTATAGCCCAAAGTTCTGGAAAAATGATGAGT
CGATGTGGGAAATGCTATAGATTTATGAATTATCTCGCTTTAAGACCTAGTCGATTATAT
TGCCCAAACTGTGAACTTACATACAAACTTCCTCAAAATGGTAACATCCGACAATACAAA
GAACAAAAATGCCCAGTTGATGGTTTTGAGCTTATTCAATTCAAAACCGAAAGAATCTCT
TATGTTTTATGTCCAGCATGTTATAATGATCCACCTTTTGAAGGATCACGTCCAGGGTTA
ACATGTATGAATTGTCCTCAATATGATTGTCCTAATAATTTCTATAAAAATCCAGTTGCC
GGGTGTCCTAAATGTGAAAATGATATGCTTTTGACTGATTTGAATAAACCTAATTGGAAA
ATATCATGTATAGAATGTCATTATGCAGAAAATGTTTTTGGAGGGGCGAAAAATGTAGAA
GTGACTGAAGATTTTTGTGAAGAATGTGGAGCGGCGATATTGAAAGCGAAATATGATGAT
AAAGAAGTTGTAGAATGCGTTTTTTGTAGTGGAGTTGCTGGGGGTATAAATGAAAGACCG
GAAAGTTCAAGAGGAGAAAGAGGAGGAAGAGGGGGAAGAGGTGGAAGAGGTGGATATAGA
GGAAGAGGTGGACATAAAGGAAGAGGAGGACGTGGGAGAGGAGGAAGGAGAGGGAGAGGA
AGAGGGAGAGGAAGAGGAGGTTATGGAAAGGGTACTGATGATCGGATGACTTTTGATGGT
TTTTAG