Identifiers and Description

Gene Model Identifier

SteCoe_7026

Standard Name

None

Aliases

None

Description

KH_6 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig16332.0.g853.873997628687187e-21Exosome complex exonuclease RR
P4 N-terminal region

Saccharomyces CerevisiaeYHR069C2.1151310375910805e-19Exosome non-catalytic core com
ponent; involved in 3'-5' RNA
processing and degradation in
both the nucleus and the cytop
lasm; predicted to contain RNA
binding domains; has similari
ty to human hRrp4p (EXOSC2)
Tetrahymena ThermophilaTTHERM_005865405.74952226429356e-19Exosome complex exonuclease
WormBaseWBGene000222320.000000000000001713908431542013

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_7026(Protein)
MELDRVLVMPGDEVRCPQGSMPGFGTYENSEGKIVANQIGYPAIYNKLVCVNPVRGRYIG
ETSNVIIGRIAQVANKRWKVNVGSPQEAVLHLSAIDLPTGEHRIRSEEDQLHMREYFNYN
DLLSAEVQSLTQDGKSMALQTRSNKFGKLKNGMLVKVSPMLVGRMRHHFVQISGVDVIFG
RNGWIWVYLAHNAEVEVPLNVRQEIVRVACVIKLLNLAKKVICAESVKEVMDCLKEVLID
EILSKNSLGIVKENAWGIEGEV


>SteCoe_7026(CDS)
ATGGAGCTTGATCGAGTCCTAGTGATGCCTGGGGATGAGGTCAGATGTCCACAAGGATCA
ATGCCAGGTTTTGGCACCTACGAAAACAGTGAAGGTAAAATTGTAGCAAATCAAATCGGC
TACCCAGCTATCTACAACAAATTAGTCTGTGTAAACCCAGTCCGAGGTCGCTACATTGGT
GAGACTTCTAATGTGATCATAGGCCGGATAGCTCAAGTAGCTAACAAAAGATGGAAAGTT
AATGTAGGTTCTCCTCAAGAAGCAGTCCTCCATCTATCAGCAATCGACTTACCAACAGGT
GAGCATCGTATAAGATCAGAAGAAGATCAGCTTCATATGCGAGAATACTTCAATTACAAT
GATTTGCTTAGTGCTGAAGTACAATCTTTAACTCAAGATGGTAAGTCAATGGCTTTGCAA
ACTAGAAGTAATAAGTTTGGTAAGCTTAAAAACGGCATGCTAGTCAAAGTCAGTCCTATG
CTTGTTGGAAGAATGAGACATCATTTTGTTCAGATTTCAGGCGTTGATGTGATTTTTGGA
AGGAACGGGTGGATTTGGGTGTATTTAGCTCATAATGCTGAAGTTGAAGTGCCACTGAAT
GTTAGACAGGAGATTGTTCGGGTTGCTTGTGTGATAAAACTTTTGAACCTTGCTAAGAAA
GTTATATGTGCAGAAAGTGTTAAAGAGGTTATGGATTGTCTTAAAGAAGTGTTGATTGAT
GAGATATTGAGTAAGAACTCATTGGGGATTGTTAAAGAAAATGCTTGGGGGATTGAAGGA
GAAGTGTAA