Identifiers and Description

Gene Model Identifier

SteCoe_7042

Standard Name

None

Aliases

None

Description

PCI domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig21741.0.g71.0806392777072785e-30PCI domain

Tetrahymena ThermophilaTTHERM_005789403.532628572200807e-24Fusion of uncharacterized prot
ein and 26S proteasome subunit
.
PCI domain containing prote
in
WormBaseWBGene000044612.6102790696677047e-23
Saccharomyces CerevisiaeYDL147W1.9287498479639178e-22Subunit of the CSN and 26S pro
teasome lid complexes; similar
to mammalian p55 subunit and
to another S. cerevisiae regul
atory subunit, Rpn7p; Rpn5p is
an essential protein; the COP
9 signalosome is also known as
the CSN

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_7042(Protein)
MEEDYLKDLLIREKELRQAEEVSAADCEKVMCEILERVKARGNWDVVGEWVQVLSKRRRQ
PKQAIVGMIKHSMSYLDTLARDHMLLDTIRTVCEGKIYLEIEFARLTKRMSENYEAKNDL
EKASSLLQEVQVETYGSMDKSEKLNFLLEQLRLLLLLKDYVRFQIISKKVNKKILDEKGM
EDNKIRFLKYMIEYYDHGKDYMEVALSYKTMGEVMGQSMEGINALQEMVVNLLLVSYSAE
QIDLLRRVPESIDSDLLEVVGIITGKELGQPKESVKKLMNDEKWKTLIRRINQHNIRTVQ
VYYKRITLRRLAELLGMSIDDAEAEIRDMVSYMGFSAKINRLEGFVYFSKKTDAQDRLNE
WGNDIFSLLNKLEETTHLIHRERIINK


>SteCoe_7042(CDS)
ATGGAAGAGGACTATCTGAAAGACCTTTTGATTCGTGAAAAAGAACTCCGCCAAGCTGAA
GAAGTGAGCGCAGCTGATTGTGAAAAAGTCATGTGTGAAATACTAGAAAGAGTCAAAGCT
CGAGGAAACTGGGATGTAGTAGGCGAATGGGTACAAGTGTTATCAAAAAGGCGCCGTCAG
CCAAAACAAGCAATAGTCGGTATGATTAAACATTCAATGTCTTATCTTGATACCCTTGCT
CGTGATCACATGCTTTTAGACACAATCCGCACAGTTTGCGAAGGTAAAATTTATTTGGAA
ATCGAATTCGCTAGACTTACAAAACGTATGTCTGAAAACTATGAAGCAAAAAATGACTTA
GAAAAAGCATCATCTCTACTTCAAGAAGTCCAAGTCGAAACATATGGTTCAATGGACAAG
TCAGAAAAATTGAATTTCTTACTTGAACAGCTTCGATTATTACTTTTACTCAAAGACTAC
GTTCGTTTTCAAATCATCAGTAAAAAAGTTAACAAGAAAATCCTTGATGAAAAAGGTATG
GAAGATAATAAAATCAGGTTCCTTAAGTATATGATTGAATATTATGATCATGGAAAAGAT
TATATGGAAGTTGCTTTATCTTATAAGACCATGGGTGAAGTAATGGGACAATCTATGGAA
GGTATTAATGCATTACAAGAAATGGTTGTTAATTTGTTACTTGTGAGTTATTCTGCTGAA
CAAATAGATTTATTAAGAAGAGTACCTGAGAGTATTGATTCAGATCTTTTGGAAGTTGTG
GGAATTATAACTGGAAAAGAACTTGGTCAACCAAAGGAAAGTGTGAAGAAACTTATGAAT
GATGAGAAATGGAAGACTTTGATTAGAAGGATTAATCAACATAATATTAGAACGGTGCAG
GTGTATTATAAGAGAATTACTTTAAGAAGGTTGGCAGAACTTCTTGGGATGAGTATTGAT
GATGCTGAAGCTGAGATTAGAGATATGGTCAGTTATATGGGATTTTCAGCTAAAATCAAT
AGACTTGAAGGCTTTGTGTATTTTTCTAAAAAAACTGATGCACAGGATAGATTGAATGAA
TGGGGTAATGACATCTTTTCTTTGTTAAATAAACTAGAAGAAACCACTCATCTAATCCAT
AGAGAAAGAATCATCAATAAGTAG