Identifiers and Description

Gene Model Identifier

SteCoe_7112

Standard Name

None

Aliases

None

Description

DNA_pol_A_exo1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006304402.031092662734811e-423'-5' exonuclease family prote
in
Oxytricha TrifallaxContig8740.0.1.g101.185064864233981e-273'-5' exonuclease

Saccharomyces CerevisiaeYOR001W0.00000000000003442477108469977Nuclear exosome exonuclease co
mponent; has 3'-5' exonuclease
activity that is regulated by
Lrp1p; involved in RNA proces
sing, maturation, surveillance
, degradation, tethering, and
export; role in sn/snoRNAs pre
cursor degradation; forms a st
able heterodimer with Lrp1p; h
as similarity to E. coli RNase
D and to human PM-Sc1 100 (EX
OSC10); mutant displays reduce
d transcription elongation in
the G-less-based
WormBaseWBGene000007960.00000000000009357622968840175

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_7112(Protein)
MLAWFLIFLAILITFYVYRKSRKSKSIVYFPVLDSERKLCLEYINSLPTEYTIPTLPLVP
LNPSTILYVQTPSQLQSILSFLESSSHIGVDIEEYRSNSYLGYICLLQLSTTNFTYLIDA
LSLRKEILTLKPIFMNKNITKIFHHAHNDTQWLQRDFGILCVNIFDTQLAAQSLGYKKLG
LNYLWKKHCKYLMSSEYKKTMQVSRWDKRPLSQEQQNYAALDAHYMGYLMGVMGKLMSKE
NLEYVRRETNKICAKEFSNAVDYDKCLKVMKKNSGQAIDSQNTEIFFRIFKMRDELAQKL
NYFPESVCSTTYMLFVANEKNPDVESFPKEFTNSILCKNHLNDIVQAIKTGLEIPLDISR
EPLGTNQQRIAKKQKRYKTFIEKYTIKKKVYDNCQIQAPDGEILCYADLKKTKWYVERQL
AEIISENPQIIRLNFEPNGRGFSDVEADQMHYSKEKRNECVGCGNTTSYLRYHVVPVLYR
QFFPENYKSHRSHDVVLLCSNCHQIANKHSDVFKKQIAKEYDVPLNFYSDIHKAKENIYG
IRKLCISLLKNNERLPEDRKKFLENKVQIFMDENPQYNALFEGFSMNEMVNKFSKEEYCK
ELLKVYGEFNWKKDIGNAHGKKVVEKITDLKSFIRRWRVHFINTLQPRFLPDSWSVDHLL
NSPKFK


>SteCoe_7112(CDS)
ATGTTAGCTTGGTTTCTGATTTTCTTAGCTATACTCATAACATTCTATGTTTATCGTAAG
TCAAGAAAATCTAAATCCATAGTTTACTTTCCTGTTTTAGATTCCGAACGAAAATTATGT
TTAGAATATATAAACTCATTACCTACAGAATACACAATCCCTACACTTCCTTTAGTTCCA
TTAAACCCTTCAACTATCTTATATGTTCAAACTCCTTCTCAATTACAATCAATTCTCTCA
TTCTTAGAATCAAGTTCACATATTGGTGTTGATATCGAAGAGTACCGAAGCAATTCTTAT
CTTGGTTATATTTGCCTTTTACAACTATCCACAACAAATTTCACTTATTTAATTGATGCT
CTTTCATTACGTAAAGAAATTCTAACTCTTAAACCTATTTTCATGAACAAAAATATCACA
AAAATTTTCCATCATGCCCACAATGATACCCAATGGCTTCAAAGAGATTTTGGAATTTTA
TGTGTTAATATTTTTGATACCCAACTTGCAGCACAAAGTTTAGGATATAAAAAACTTGGG
TTAAATTATTTATGGAAAAAACATTGTAAGTATTTAATGAGTTCAGAATACAAAAAAACC
ATGCAAGTTTCTAGATGGGATAAAAGACCTTTAAGTCAAGAACAACAAAATTATGCAGCT
TTAGATGCTCATTATATGGGGTATTTAATGGGAGTAATGGGTAAGTTGATGAGTAAAGAA
AATCTTGAATATGTTAGAAGGGAAACAAATAAAATTTGTGCTAAAGAGTTTAGTAATGCT
GTAGATTATGATAAATGCTTAAAAGTTATGAAGAAAAATAGTGGGCAAGCTATTGATTCA
CAAAATACTGAGATTTTCTTTAGGATTTTTAAAATGCGAGATGAGCTTGCCCAGAAACTT
AATTACTTTCCTGAATCAGTTTGTTCTACAACTTATATGCTGTTTGTAGCTAATGAGAAA
AATCCTGATGTAGAAAGTTTTCCTAAAGAATTTACAAACTCAATTTTGTGTAAAAATCAT
TTAAATGATATTGTTCAAGCTATAAAAACTGGTCTTGAAATACCTTTAGATATATCTAGA
GAGCCTTTAGGAACGAATCAACAAAGGATTGCTAAGAAGCAAAAAAGATATAAAACATTT
ATAGAAAAATATACTATAAAGAAAAAAGTTTATGATAATTGTCAGATTCAAGCCCCTGAT
GGAGAGATACTTTGTTATGCTGATTTAAAAAAAACTAAATGGTATGTGGAAAGACAATTA
GCAGAAATAATTTCTGAAAACCCTCAAATCATAAGATTAAACTTTGAACCAAATGGCAGA
GGCTTCAGCGATGTTGAAGCTGATCAAATGCATTATAGTAAAGAAAAACGTAATGAATGT
GTTGGTTGCGGAAATACAACAAGTTATTTACGATATCATGTTGTTCCTGTTCTTTATAGA
CAATTCTTCCCTGAAAATTATAAAAGCCATAGAAGTCATGATGTTGTCCTTTTATGTTCA
AATTGTCATCAAATAGCAAATAAACATAGTGATGTATTTAAAAAACAAATCGCTAAAGAA
TATGATGTCCCTTTAAACTTTTATAGTGATATACATAAAGCTAAAGAAAATATTTATGGG
ATAAGAAAACTCTGTATTAGTCTTTTAAAAAATAATGAAAGACTTCCTGAAGATAGAAAA
AAATTCCTTGAAAATAAAGTGCAAATTTTTATGGATGAAAACCCACAATATAATGCACTT
TTTGAAGGATTTTCTATGAATGAAATGGTTAATAAGTTTAGTAAGGAAGAATATTGTAAA
GAACTTTTAAAAGTTTATGGGGAGTTTAATTGGAAAAAAGATATTGGGAATGCTCATGGT
AAGAAAGTTGTTGAAAAAATCACTGATTTGAAGTCTTTTATAAGGAGATGGAGGGTTCAT
TTTATTAATACTTTACAGCCAAGATTTCTTCCTGATTCATGGAGTGTAGACCATTTACTT
AATTCACCAAAATTCAAGTAA