Identifiers and Description

Gene Model Identifier

SteCoe_7522

Standard Name

None

Aliases

None

Description

RNA_pol_L domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22041.0.g301.5007857627073948e-41RNA polymerase Rpb3/RpoA inser
t domain

Tetrahymena ThermophilaTTHERM_000942103.0144087850653746e-40Fifth largest subunit of RNA p
olymerases I and III; homolog
of RPC40 in yeasts and RPA40 i
n humans; expressed in macronu
cleus of vegetative cells and
weakly in early stages of conj
ugation
WormBaseWBGene000192755.900090541597061e-29
Saccharomyces CerevisiaeYPR110C4.359610000063081e-28RNA polymerase subunit AC40; c
ommon to RNA polymerase I and
III

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_7522(Protein)
MDVNMAQLKSHTLENTQTIEHPSSGGKALSDIFDNLTLEIIEENPDDMIIDIKGIEAPLA
NALRRIMISEVPTMAIEDVDLYQNTSVIPDEVLAHRLGLIPIYAEPEKFKYKTQEDSHNG
ENSILFKLHVKCIRLQDKSIQNENVYSRDLIWSPLPGQEKMHIAPVHSDILIAKLGPGQE
IEAELWCEKGIGATHTKWSPVCTASYRLMPSITLSQILKGENAKALKRKCQAKVFDIEDG
KAIVANMRDCTSCRECLRDENFGVVLGKVKDHFIFSIESTGILKPRRILRDAILILKKKA
RDWIDIINVYKHTPKS


>SteCoe_7522(CDS)
ATGGATGTGAATATGGCTCAGCTAAAATCTCATACATTAGAAAACACACAAACCATCGAG
CATCCATCATCAGGAGGTAAAGCTCTATCCGATATCTTCGATAACCTCACTCTAGAAATA
ATCGAAGAAAATCCTGATGATATGATAATCGACATCAAAGGTATTGAAGCTCCATTAGCT
AATGCATTACGAAGGATAATGATATCTGAAGTTCCAACAATGGCTATTGAAGATGTTGAT
CTATATCAAAATACATCAGTAATTCCTGATGAAGTCTTGGCTCATAGACTAGGGCTTATC
CCAATATACGCAGAACCAGAGAAGTTTAAATACAAAACTCAAGAAGATAGCCACAATGGT
GAAAACTCGATTTTGTTTAAACTTCATGTTAAATGCATAAGATTACAAGACAAGTCAATA
CAAAATGAAAATGTTTATTCAAGAGATCTTATATGGAGTCCATTGCCAGGACAAGAAAAA
ATGCATATCGCCCCAGTCCATTCTGATATTCTTATAGCAAAATTAGGTCCTGGTCAAGAA
ATTGAAGCTGAATTATGGTGTGAAAAAGGTATTGGAGCTACACATACAAAATGGTCACCT
GTATGTACTGCTAGTTATAGACTTATGCCATCTATAACATTAAGTCAAATACTTAAAGGG
GAAAATGCTAAAGCGTTAAAGAGAAAATGTCAAGCTAAGGTTTTTGATATTGAAGATGGG
AAAGCTATTGTTGCTAATATGAGAGATTGTACTTCGTGTAGAGAATGCTTAAGGGATGAG
AATTTTGGAGTTGTTCTTGGGAAAGTTAAAGATCATTTTATATTTAGTATTGAAAGTACG
GGGATTTTAAAACCTAGAAGGATACTTAGAGATGCGATTTTGATATTGAAGAAAAAAGCT
CGTGATTGGATAGATATTATTAATGTGTATAAGCATACACCTAAGAGCTAA