Identifiers and Description

Gene Model Identifier

SteCoe_7710

Standard Name

None

Aliases

None

Description

Proteasome_A_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511
  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig21046.0.g142.9374821117108028e-30Proteasome subunit

Saccharomyces CerevisiaeYOR362C3.221340285992516e-27Alpha 7 subunit of the 20S pro
teasome; protein abundance inc
reases in response to DNA repl
ication stress
WormBaseWBGene000039284.780892883885469e-25
Tetrahymena ThermophilaTTHERM_004871103.532628572200807e-2420S proteasome core alpha subu
nit 7

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_7710(Protein)
MSGAGTGYDLSPTTYNPEGRVFQVDYAIKATENGGTIIGLKCRDGILLAGEKNVVSRMMM
EGSNKYIFGVTKEIGAVITGVIPDGKSVITRARQEASQYSEFYGQPIKPTVLADRVAQYM
YLFTLYGGLRPFGSTIMLAGRYQNEYRLFMLDPSGAMFEYYSCTAGKGSQVCRTEIDKLR
LEDITVRDAVYHVCRMLIKSREETRDKRYEIDMGWVSEESFGLFVPVPTEFRKEMENKAK
EDIEREERGE


>SteCoe_7710(CDS)
ATGAGTGGAGCTGGAACAGGATACGACTTATCCCCGACGACCTATAATCCAGAAGGAAGG
GTGTTCCAAGTGGACTATGCTATCAAAGCAACAGAAAATGGTGGGACGATAATTGGCTTG
AAATGCAGAGATGGGATTTTGTTGGCAGGGGAGAAAAATGTTGTGTCTAGAATGATGATG
GAAGGCAGTAATAAATACATTTTTGGTGTGACAAAAGAGATTGGAGCTGTGATTACTGGG
GTCATTCCTGATGGCAAATCAGTGATAACAAGAGCAAGACAAGAAGCTTCACAGTATAGT
GAGTTTTATGGGCAACCGATAAAGCCTACAGTATTGGCAGATCGTGTGGCGCAGTATATG
TACTTGTTTACTTTATATGGAGGGTTGAGACCATTTGGCTCTACAATTATGTTAGCTGGG
AGATACCAGAATGAATATAGGCTATTTATGCTAGACCCATCAGGGGCTATGTTTGAATAT
TACTCATGCACAGCTGGAAAAGGTAGTCAAGTTTGTAGGACTGAAATAGACAAGCTAAGA
CTTGAAGATATCACAGTACGAGATGCTGTTTATCATGTATGCCGAATGTTGATCAAAAGT
AGAGAAGAAACCCGAGACAAAAGATATGAAATTGATATGGGCTGGGTGAGTGAGGAATCT
TTTGGGCTATTTGTCCCTGTTCCTACCGAATTCAGAAAAGAAATGGAAAACAAAGCCAAA
GAAGATATTGAAAGAGAAGAACGTGGTGAGTAG