Identifiers and Description

Gene Model Identifier

SteCoe_7779

Standard Name

None

Aliases

None

Description

PhoLip_ATPase_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig19960.0.g510E1-E2 ATPase

WormBaseWBGene000191660

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_7779(Protein)
MSAEETDFSSRTIWANFPEVNQGFANNCVKTTKYNLLTFLPFSLFIQFRRVSNIYFLITA
ILQSIPQISPLQPFTAIAPLVFVLGVSMIREGIEDYLRYKSDKEINSSPTMIYKKGRFQQ
VCFEDIKVGDVVFVVKNQVFPCDIVMLSNSNENGTAYIETSSLDGEKALKSRQAFVHTQG
LFTDDKANRIASMIKCELPNSRLYNFSGTFEFHSVKYPLDKAHLLLAGAFLRNTEWAIGV
SVYTGGDTKLRQNMMGRKYKESRIEHNANRYIALIIILQFCLCIACAIASGYWVSQNIHE
HTYIRYEKSYDIYDKGGMQGFLSYFTYFLLLNTMLPISLIISLELLKLGQGFFMMMDIMM
YSEKRDRCCKVSSFSLNEELGMIKHIFSDKTGTLTCNQMEFKFFCTGTRIYGDQSVLFNL
GLKTKVTFEDREIKFTFNDKHVENDLFSDHEIKLKYPVVMREEGIVIDTQRQITDLIIKC
LALCHECIIENTEEEGLKYTGPSPDDVVLVDTARRIGYTLMKIKSEKMYLEINNKLKDIT
TNETFERICILEFNSDRKRMSVVLKDLKTGKYMIFMKGADNFIIERLSSENHRENIARLG
ELVGSFSRRGFRTLVMSFKYISEEDFNSWKVKYDEAITQINGREAAVAKVAEEIETDMYL
LGCTAVEDALQDDVPETINDLLKAGLSFWMLTGDKLETAENIGKTCSLIDDNMVVEKCSV
LTAEDCYKRMKEAYKNFKKNLNEKQLALIIEGSALQIVLYDYDDMAKREKFIEISNSENN
RLAASKAKKYFLKMSNICKTIICCRVSPGEKREVVKLVKDNTDKVTLSIGDGANDVPMIL
EAHIGVGLYGEEGIQAVQASDYALGEFRYLWELLLVHGRFNYIRQSEMILYFFYKNLVFT
LPQFLFAHYCAYSGQTVYDDWYLTFYNLVFTALPLFMRALFERDYEVPKRWESTGDNAID
DKKALRKRIPTVYKVGMDNQLFTLSRFVLWIFNGILHAIIVFFIPLYASEEGIMDSDGRS
YDQWSFSIASFSSIIIIVNLKLAINTKLWNKFHYICMFGLSILLYFVFILIYDAVTYTSS
YRTVYTLLGTHYYYFCILANVFLVCAIDVAFTTVTKIFWPTDSDIMAQETISLKKGHRKT
MSGFTINENSNSDKCNEYEVNKEKNRFEAENLTMNPSVKKVDPEDYSSMKNVDQEDNDEK
ILVNSGDKITKKHNYEEE


>SteCoe_7779(CDS)
ATGTCAGCAGAGGAGACCGATTTTAGCAGCCGTACTATCTGGGCGAACTTTCCTGAAGTA
AATCAAGGTTTTGCAAACAATTGTGTAAAGACAACCAAATACAATCTTCTAACCTTTCTC
CCATTTTCCTTGTTTATTCAATTCCGTAGAGTCAGCAACATATATTTTCTCATAACTGCG
ATTCTTCAATCTATTCCTCAAATCTCCCCATTGCAGCCATTTACGGCAATAGCTCCTTTA
GTTTTCGTACTGGGGGTAAGTATGATTAGAGAAGGCATAGAAGATTATTTAAGGTATAAA
AGTGATAAGGAAATCAATAGTAGCCCAACAATGATATATAAAAAAGGGAGATTCCAACAA
GTGTGTTTTGAAGATATAAAGGTTGGTGATGTAGTTTTTGTTGTCAAAAATCAGGTTTTT
CCTTGTGACATTGTAATGCTTTCTAATTCAAATGAAAATGGGACAGCTTATATTGAAACA
TCGTCACTTGATGGAGAAAAGGCTCTTAAATCTAGACAGGCCTTTGTCCATACTCAAGGA
CTTTTTACTGATGACAAGGCTAATAGGATTGCGAGCATGATTAAATGCGAGCTTCCCAAT
TCCCGGCTGTATAACTTTTCTGGTACATTTGAGTTCCATTCTGTTAAATATCCACTTGAC
AAAGCCCATTTGCTACTTGCAGGGGCTTTTCTTCGTAATACCGAATGGGCGATTGGGGTA
TCAGTCTACACTGGCGGAGATACAAAACTTCGTCAAAATATGATGGGCCGAAAATACAAA
GAAAGCCGTATTGAGCATAATGCAAATCGCTATATAGCCCTTATTATAATCTTACAATTC
TGTTTATGCATAGCTTGTGCCATAGCTTCTGGTTATTGGGTAAGTCAAAATATTCATGAG
CACACTTACATTAGATATGAAAAAAGTTATGATATATATGACAAAGGCGGTATGCAAGGG
TTTTTAAGCTATTTCACATACTTTCTTTTACTAAACACAATGCTCCCAATATCTTTAATA
ATATCATTAGAGCTGCTTAAACTAGGACAAGGGTTTTTTATGATGATGGATATTATGATG
TATAGTGAAAAACGCGATCGTTGCTGCAAAGTGAGTTCATTTAGTCTTAATGAAGAACTA
GGAATGATCAAACATATTTTTAGTGATAAGACTGGGACATTAACTTGCAATCAGATGGAA
TTTAAGTTCTTTTGTACTGGGACAAGGATTTATGGTGACCAAAGTGTACTTTTTAACCTT
GGTTTAAAGACAAAAGTTACGTTTGAAGATAGAGAAATTAAATTCACTTTTAATGATAAA
CATGTTGAAAACGACCTTTTTAGTGACCATGAAATAAAACTTAAATACCCTGTTGTTATG
AGAGAAGAAGGTATTGTTATTGATACCCAAAGACAAATTACTGATTTAATAATAAAATGC
CTTGCTTTATGCCATGAATGCATTATTGAAAATACTGAAGAAGAAGGACTTAAGTACACA
GGGCCTAGTCCAGATGATGTAGTACTTGTTGATACAGCTCGGAGGATTGGCTACACCCTG
ATGAAAATTAAGTCTGAAAAAATGTACTTGGAAATCAATAACAAACTAAAAGATATCACT
ACAAACGAAACTTTTGAAAGGATTTGTATACTAGAATTTAATTCTGATAGAAAAAGAATG
TCAGTTGTTCTAAAAGATTTAAAAACAGGTAAATACATGATTTTTATGAAAGGTGCTGAC
AACTTCATCATTGAAAGATTGTCTTCAGAAAATCATCGTGAGAACATAGCTAGGCTTGGG
GAACTTGTTGGATCATTCTCACGAAGAGGTTTTAGAACTTTAGTTATGAGTTTCAAATAT
ATATCTGAAGAAGATTTCAATAGTTGGAAAGTTAAATATGACGAAGCTATTACGCAGATT
AACGGCAGAGAAGCTGCTGTTGCTAAAGTTGCTGAGGAGATTGAAACAGATATGTACCTT
CTTGGATGCACAGCAGTTGAAGATGCTTTACAAGATGATGTTCCTGAAACAATAAATGAT
TTACTTAAAGCTGGTTTAAGCTTTTGGATGCTTACTGGAGATAAATTAGAAACAGCTGAA
AATATTGGTAAGACTTGTTCTTTGATAGATGATAATATGGTTGTGGAAAAATGTTCAGTT
TTAACAGCTGAGGATTGCTATAAAAGAATGAAAGAGGCTTATAAGAATTTCAAGAAAAAT
TTGAATGAAAAGCAACTTGCTCTAATTATTGAGGGCTCAGCTTTACAAATTGTTCTTTAT
GACTATGACGACATGGCGAAAAGAGAGAAGTTTATCGAGATTTCAAATAGTGAAAATAAT
AGACTCGCTGCTTCTAAGGCTAAGAAGTACTTTTTAAAAATGTCGAATATTTGCAAGACA
ATTATTTGTTGTAGGGTCTCGCCTGGAGAAAAAAGAGAAGTCGTAAAATTAGTCAAAGAT
AATACTGATAAAGTTACCCTATCAATAGGTGATGGGGCAAATGATGTTCCGATGATATTA
GAAGCACATATTGGTGTAGGACTTTATGGAGAAGAGGGTATCCAAGCTGTTCAAGCTAGT
GACTATGCTTTAGGTGAATTCAGATATCTTTGGGAACTTCTTCTTGTTCATGGAAGATTC
AATTATATAAGACAAAGTGAAATGATTCTCTATTTCTTTTATAAAAACTTAGTCTTCACA
TTACCTCAATTCCTTTTTGCCCATTATTGCGCATACAGTGGTCAAACTGTTTATGATGAT
TGGTATTTGACCTTCTACAATCTTGTCTTCACAGCTTTGCCTTTATTCATGAGGGCACTT
TTTGAAAGAGATTATGAAGTTCCTAAAAGGTGGGAGTCAACAGGAGACAATGCTATAGAT
GACAAAAAAGCACTTAGAAAAAGAATACCAACAGTATATAAAGTTGGAATGGATAACCAG
CTTTTTACATTATCAAGATTTGTATTGTGGATATTTAATGGGATTTTACATGCAATTATT
GTGTTTTTTATACCACTTTATGCTTCAGAAGAAGGAATTATGGACTCAGATGGTAGAAGT
TATGACCAATGGAGTTTCTCAATCGCATCTTTTTCATCGATTATCATTATTGTCAACCTT
AAATTGGCTATAAACACGAAACTTTGGAATAAATTCCATTACATTTGCATGTTTGGGCTT
AGTATTTTACTATACTTTGTCTTTATTCTAATATATGATGCTGTTACTTATACTTCATCA
TATAGAACAGTTTATACATTGCTAGGTACTCATTATTATTATTTTTGTATACTGGCTAAT
GTCTTTTTAGTCTGTGCAATTGATGTAGCTTTTACTACAGTAACTAAAATTTTCTGGCCT
ACGGATTCAGATATTATGGCACAAGAGACTATTTCATTGAAGAAAGGACATAGAAAGACT
ATGTCTGGATTTACTATAAATGAGAATTCAAACAGTGATAAATGTAATGAATATGAAGTT
AATAAGGAAAAAAATAGGTTTGAAGCTGAAAACTTGACTATGAATCCATCGGTAAAAAAA
GTTGATCCAGAAGATTATAGTTCTATGAAAAACGTGGATCAAGAAGATAATGATGAGAAA
ATATTGGTTAATAGTGGAGATAAAATTACGAAGAAGCATAATTACGAAGAAGAATAG