Identifiers and Description

Gene Model Identifier

SteCoe_7821

Standard Name

None

Aliases

None

Description

GSK family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22618.0.g462.001470128041443e-75Protein kinase domain

WormBaseWBGene000017461.4411565509640892e-64
Tetrahymena ThermophilaTTHERM_005326803.917469664450395e-64Protein kinase domain containi
ng protein. Sequence similarit
y to the GSK protein kinase fa
mily (Eisen et al., 2006)."
Saccharomyces CerevisiaeYMR139W2.820770088460135e-53Protein kinase; required for s
ignal transduction during entr
y into meiosis; promotes the f
ormation of the Ime1p-Ume6p co
mplex by phosphorylating Ime1p
and Ume6p; shares similarity
with mammalian glycogen syntha
se kinase 3-beta; protein abun
dance increases in response to
DNA replication stress; RIM11
has a paralog, MRK1, that aro
se from the whole genome dupli
cation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_7821(Protein)
MRPKSKVVHNISTASANVRVGEINTSLQRMSLSDKTGSHTYTSDKVVGNGTFGVVYQATI
AETGEKVAIKKVFQDKRYKNREYEIMKELSHPNVVGLRHAFYTPGDKPDEVFLNLVMEYF
PDTLYRVTKNYGRMRQPIPLIIAKLYSYQILRSLGYIHAMGVCHRDIKPQNLLVDPATHR
LVLCDFGSAKKLVRGEPNVAYICSRYYRAPELIFGATDYTTLIDIWSAGCVIAEMFIFQP
LFPGESAVDQLVEIIKVLGTPTREQIFEMNPNYHEGRFPDIRQTPWSRVFKNKASPEAID
LLASLLVYSPSKRLTAYQAMQHPFFDELRAQGTRLPNGDPLPPLFNWSEIEIKTHPELIR
ALTPSWFSN


>SteCoe_7821(CDS)
ATGCGTCCAAAATCAAAAGTTGTTCATAACATATCAACAGCCTCAGCTAATGTCCGTGTA
GGGGAGATAAACACATCTCTTCAAAGGATGAGTCTAAGTGATAAGACAGGCAGCCATACC
TACACCTCAGACAAAGTTGTAGGCAATGGGACATTCGGAGTAGTTTACCAAGCAACAATT
GCAGAAACTGGGGAAAAAGTTGCAATAAAAAAAGTATTCCAAGACAAGCGATATAAGAAC
CGAGAATACGAAATAATGAAAGAACTTTCTCATCCAAACGTCGTAGGCCTTCGTCATGCT
TTTTACACTCCAGGCGATAAGCCAGACGAAGTTTTTCTAAATCTGGTTATGGAGTATTTC
CCAGACACCTTATACCGAGTGACAAAAAATTATGGACGAATGAGACAGCCAATCCCTTTA
ATAATAGCCAAATTATACAGCTATCAAATATTAAGATCACTAGGATATATTCATGCAATG
GGAGTTTGTCATAGAGATATCAAGCCTCAAAATTTACTTGTAGATCCAGCTACTCATAGA
CTTGTTTTATGTGATTTTGGTTCTGCTAAAAAATTAGTTAGAGGGGAACCAAATGTTGCT
TATATATGTTCAAGATATTATCGAGCACCTGAATTAATATTTGGAGCTACAGATTATACT
ACACTTATTGATATATGGAGTGCTGGATGTGTTATTGCTGAAATGTTTATTTTCCAGCCT
TTATTCCCTGGAGAAAGCGCAGTTGATCAATTGGTGGAAATTATTAAGGTTCTTGGAACA
CCTACAAGGGAACAGATATTTGAAATGAATCCTAATTATCATGAAGGACGATTTCCGGAT
ATTAGACAAACCCCATGGAGTAGGGTTTTTAAGAATAAAGCTTCACCTGAAGCTATTGAT
TTGTTAGCATCGTTACTCGTTTATTCACCATCTAAAAGACTTACGGCTTATCAGGCGATG
CAACATCCGTTCTTTGATGAACTTAGAGCTCAAGGTACGAGATTACCTAATGGTGACCCT
TTACCACCTCTTTTTAATTGGAGTGAGATTGAAATTAAAACTCATCCTGAACTCATACGT
GCTCTTACTCCTAGTTGGTTTAGTAATTAG