Identifiers and Description

Gene Model Identifier

SteCoe_7851

Standard Name

None

Aliases

None

Description

E1_dh domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor (IEA) | GO:0016624

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig9079.0.0.g831.9503933001302485e-65Dehydrogenase E1 component

Tetrahymena ThermophilaTTHERM_001932305.301718666092324e-65pyruvate dehydrogenase complex
E1 component, catalyzes the d
irect oxidative decarboxylatio
n of pyruvate to acetyl-CoA
WormBaseWBGene000115107.667648073722e-53
Saccharomyces CerevisiaeYER178W4.590938473882946e-48E1 alpha subunit of the pyruva
te dehydrogenase (PDH) complex
; catalyzes the direct oxidati
ve decarboxylation of pyruvate
to acetyl-CoA; phosphorylated
; regulated by glucose; PDH co
mplex is concentrated in spots
within the mitochondrial matr
ix, often near the ERMES compl
ex and near peroxisomes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_7851(Protein)
MACSRLFRNFALTVKLPSVTTHKFDSGLLPTETVTTKEELMKYFNDMFTIRRIEITSDAY
YKNAEIRGFCHLCDGQEGIYVGMEAGVTHDDCLITAYRDHGQAYMRGETPHAIFAEMFGK
ITGTSKGKGGSMHFYNKTTNFYGGNGIVGAQVPVGVGLAFALKYQKKPNISMIMYGDGAA
NQGQVAEAANIAALWKLPAIFICENNKYGMGTAIERASANTEFYTRGDTIPGIRIEAQNI
FAVRETMKFAKKWGVEHGPLWLEFSTYRYRGHSMSDPGVSYRNKEEIDKVRATRDPIEYV
KHLILDNKLASETELEEIQDKIKEEVNKAAADAKKDPVPDAKELMTDVFSHNRKYFIRNV
ELKDSALI


>SteCoe_7851(CDS)
ATGGCTTGTAGTAGACTATTTAGGAATTTTGCTTTGACAGTAAAGCTCCCTTCAGTAACA
ACTCATAAATTCGATTCTGGTCTATTGCCAACTGAAACAGTAACAACTAAAGAAGAGCTT
ATGAAATATTTCAACGATATGTTTACTATAAGAAGAATTGAAATCACATCAGATGCTTAT
TACAAAAATGCTGAAATCAGAGGGTTTTGCCATTTATGCGATGGCCAAGAAGGGATTTAT
GTTGGTATGGAAGCTGGGGTTACTCATGATGATTGCTTGATAACAGCTTATCGTGACCAT
GGCCAAGCTTATATGCGTGGAGAAACTCCTCATGCAATATTTGCCGAGATGTTTGGTAAA
ATTACAGGGACTTCTAAAGGTAAAGGCGGTTCTATGCATTTTTATAATAAAACCACGAAC
TTTTATGGGGGAAATGGGATTGTTGGTGCCCAAGTCCCTGTTGGAGTTGGCCTAGCATTT
GCCTTGAAGTATCAGAAAAAGCCTAATATTTCTATGATTATGTATGGAGATGGGGCTGCT
AATCAAGGTCAAGTGGCTGAAGCTGCTAATATTGCAGCTTTATGGAAACTCCCTGCGATT
TTTATATGCGAAAACAATAAATATGGTATGGGTACAGCTATTGAAAGAGCTTCAGCAAAT
ACAGAATTCTATACTCGTGGAGATACTATTCCTGGTATAAGAATTGAAGCTCAAAACATT
TTTGCGGTTAGAGAAACTATGAAATTCGCTAAAAAATGGGGTGTTGAACATGGACCTTTA
TGGTTAGAATTTAGTACTTATAGATATAGAGGACATTCTATGTCTGATCCTGGGGTTAGT
TATAGGAATAAAGAAGAGATTGATAAGGTTAGAGCTACCAGAGATCCAATTGAATATGTT
AAACACTTGATTTTGGATAATAAACTTGCTAGTGAAACTGAACTTGAGGAAATACAAGAT
AAGATTAAAGAGGAAGTTAATAAAGCTGCTGCTGATGCTAAGAAAGACCCTGTGCCTGAT
GCTAAAGAGCTGATGACTGATGTGTTTAGCCATAACAGGAAGTATTTTATTAGAAATGTG
GAGCTTAAAGATAGTGCTTTAATATAA