Identifiers and Description

Gene Model Identifier

SteCoe_7917

Standard Name

None

Aliases

None

Description

DEAD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006285601.9503933001302485e-65DEAD/DEAH box helicase family
protein
WormBaseWBGene000085021.4411565509640892e-64
Saccharomyces CerevisiaeYLR398C4.2960271311739114e-61Ski complex component and puta
tive RNA helicase; mediates 3'
-5' RNA degradation by the cyt
oplasmic exosome; null mutants
have superkiller phenotype of
increased viral dsRNAs and ar
e synthetic lethal with mutati
ons in 5'-3' mRNA decay; mutat
ions in the human ortholog, SK
IV2L, causes Syndromic diarrhe
a/Trichohepatoenteric (SD/THE)
syndrome
Oxytricha TrifallaxContig21835.0.g973.1743585474772134e-60DSHCT (NUC185) domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_7917(Protein)
MRLEQKQNVFVAAHTSAGKTVVAEYAIALARERMSRVIYTSPIKALSNQKFREFKDQFGE
IGILTGDVSIDEDSFCVIMTTEILRSMLYHNSSRLRDLEWVILDEVHYINDAERGVVWEE
VLIMLPPHVRIVMLSATVPNYMEFSNWVGRVRNQKVYVQITYKRPVPLEHRIYVSGQFIT
IVEPDGKLIISNYNKAKKDLEKSMEEKGKFVQSGSKRTFKKKKINKSEDQQYKELIINLK
QNELLPCVIFAFSRDKVDKRGEKLSSVSLISDSEKHIINQFATRALKRLNPVDRELPQIL
QVLKLLNSGIGIHHSGVLPILKEIVEILFSKGLIKVLVATETFAMGLNMPTKTVVFCELR
KFDGTENRYLQPGEYTQMSGRAGRRGKDIKGTVIMFFKDAQKLPSATNLEKIVQSKPFEL
SSKFRIRYNQIVNVLNTEGMDINEIMKKSFMENQNFISKQSVSTKLLVIEKALKELGGIG
NDEEFLSLKARCEDLKTLIDINKTADGIGRKLKAGSFVECWIPGSANIPGIYLQNFGVIL
FDDTRSLKFQNDFINGTWEIQKIGIQNILWVYSGCIPKQKEKSIKLVTYFNADTVGALYN
DFMGIKRNEIVSSEQTYKKPPGQSNARGELVGKLVDSNILYHKDRHRCMINLDKIKELEI
EHGKLVQDRSSTDLMSTNETESRIEILKMYKCINSNLVVQLKGKVLGIFNNPYNLVITEA
LFDGIFSAITPEEIAGLASVFITEEKAKIDELPAGVPDTLKRSIESVNGIVEKLKEFENQ
RQISSEITDQELRIAMVEIVYLWAQGEPFVKICERTTIKEGNIVRGILRVHDLLRNIVEA
GIIMGDHTIKKKAKKAADSIQRDIAFATSLYISN


>SteCoe_7917(CDS)
ATGCGTCTCGAACAAAAGCAAAATGTATTTGTTGCCGCTCATACCTCAGCAGGTAAAACT
GTAGTAGCAGAGTACGCAATAGCTCTAGCTAGAGAACGTATGTCTCGAGTGATATACACC
AGCCCAATAAAAGCTCTTTCAAATCAAAAGTTCCGTGAATTTAAAGACCAATTTGGGGAA
ATCGGTATTTTAACTGGAGATGTGAGTATAGACGAGGACTCTTTCTGTGTAATTATGACA
ACAGAGATTCTTCGAAGTATGCTTTATCATAATTCAAGCCGTTTACGAGACTTAGAATGG
GTAATTCTTGATGAAGTTCACTATATAAATGATGCTGAAAGAGGAGTTGTCTGGGAAGAA
GTTCTTATTATGTTACCTCCACATGTTCGTATAGTCATGCTTTCTGCAACAGTGCCAAAT
TATATGGAATTCTCTAATTGGGTAGGTAGAGTTCGTAATCAAAAAGTCTATGTTCAAATT
ACTTATAAACGTCCAGTTCCTTTAGAACATAGAATTTATGTATCAGGCCAATTTATCACA
ATTGTTGAACCTGATGGGAAATTGATTATAAGCAACTATAATAAAGCTAAAAAAGACTTA
GAAAAATCTATGGAAGAAAAAGGCAAATTCGTTCAGTCAGGGAGCAAAAGGACTTTTAAA
AAGAAAAAAATCAATAAAAGTGAAGATCAACAGTATAAAGAATTAATCATTAATCTTAAA
CAAAACGAACTTTTACCTTGTGTTATTTTTGCTTTTTCTCGAGACAAAGTTGATAAAAGA
GGAGAAAAACTTTCATCTGTATCTTTGATAAGTGATTCAGAAAAGCATATAATAAACCAA
TTCGCTACTAGAGCATTGAAAAGATTAAACCCTGTTGATCGAGAACTTCCACAAATCCTT
CAAGTTCTTAAACTTCTTAATAGTGGGATTGGTATTCATCATAGTGGAGTATTACCAATT
CTTAAAGAAATAGTTGAAATATTATTCAGTAAGGGTCTTATAAAAGTTCTTGTAGCAACT
GAAACATTTGCAATGGGTTTAAATATGCCAACCAAAACTGTTGTTTTTTGTGAATTAAGA
AAATTTGATGGGACTGAAAATAGATATCTTCAGCCTGGAGAATACACACAAATGTCAGGA
AGAGCTGGAAGAAGAGGCAAAGATATAAAAGGTACAGTTATCATGTTTTTCAAAGATGCA
CAAAAACTTCCAAGCGCTACTAACCTTGAAAAAATCGTCCAGTCTAAACCTTTTGAGTTG
TCAAGTAAGTTTAGAATACGATACAATCAAATAGTTAATGTGTTAAATACTGAAGGTATG
GATATCAATGAAATTATGAAGAAAAGTTTTATGGAAAACCAAAACTTCATAAGCAAGCAA
TCAGTAAGCACAAAACTTTTAGTTATAGAAAAAGCTCTTAAAGAACTTGGTGGTATTGGT
AATGATGAAGAGTTTCTATCTTTAAAAGCAAGATGTGAAGATTTGAAAACTTTAATTGAC
ATAAACAAAACAGCAGATGGAATTGGAAGGAAACTTAAAGCTGGAAGTTTTGTTGAATGT
TGGATACCAGGTTCAGCAAATATCCCCGGAATTTATCTACAAAATTTTGGTGTGATACTT
TTTGATGACACAAGATCATTGAAATTTCAAAACGATTTTATCAACGGAACTTGGGAAATC
CAAAAAATTGGTATTCAAAACATCCTTTGGGTATATTCAGGATGTATACCAAAACAAAAG
GAAAAAAGTATCAAACTTGTCACTTATTTTAATGCAGATACAGTCGGAGCATTATATAAT
GATTTTATGGGAATAAAAAGAAATGAAATTGTCTCATCAGAACAGACTTATAAAAAACCT
CCAGGCCAATCAAATGCTCGAGGTGAACTTGTGGGGAAATTAGTTGATTCAAATATTTTA
TATCATAAAGATCGACATAGATGCATGATTAATTTAGATAAAATCAAAGAACTTGAGATT
GAACATGGAAAACTTGTTCAGGATAGATCTTCAACTGATCTTATGTCAACAAATGAAACT
GAATCTCGTATTGAAATATTGAAAATGTATAAATGCATCAATTCTAATTTGGTTGTTCAA
TTAAAAGGAAAAGTTTTAGGTATTTTCAATAACCCTTATAATTTAGTTATCACTGAAGCT
TTATTTGATGGGATTTTCTCAGCGATTACTCCTGAAGAAATTGCTGGACTTGCTAGTGTG
TTTATTACTGAAGAAAAAGCTAAAATAGATGAACTACCAGCTGGAGTACCGGATACTTTG
AAAAGAAGTATTGAATCAGTTAATGGAATTGTTGAAAAATTGAAGGAATTCGAAAATCAA
AGACAAATTTCTTCTGAAATTACTGATCAGGAATTGAGGATTGCTATGGTAGAAATTGTG
TACTTATGGGCACAGGGAGAACCTTTTGTTAAAATCTGTGAGAGAACTACTATTAAAGAA
GGAAATATTGTTAGAGGAATACTTAGGGTACATGATTTGTTAAGGAATATTGTAGAAGCT
GGGATTATTATGGGAGATCATACTATTAAGAAAAAGGCTAAAAAAGCTGCAGATTCGATA
CAGAGAGATATTGCGTTTGCCACGAGTCTTTATATTTCTAACTAG