Identifiers and Description

Gene Model Identifier

SteCoe_8041

Standard Name

None

Aliases

None

Description

Helicase_C domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12468.0.g660.00000000000009357622968840175DEAD/DEAH box helicase

Saccharomyces CerevisiaeYLR276C0.000000000005109089028063325DEAD-box protein required for
27S rRNA processing; exhibits
DNA, RNA and DNA/RNA helicase
activities; ATPase activity sh
ows preference for DNA over RN
A; DNA helicase activity aboli
shed by mutation in RNA-bindin
g domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_8041(Protein)
MAENEEGNNSNAYLEVKEESDKFIIVYTLIKLGLISGKVVIYTNTKDEGYKLKLFLEEFH
IRTLILSYQLPKATRHLVVTNFVKTNDVLIVIDPDEKESENKDTKRHKIYKAAISVLINF
NFPSNTRLFKRRITDISSERSQNLSLLSLIDPNEFKTFTNVSKKLLKQGRIPFELLEVKM
DQFEKFRYRCEDILKTVTDKKIKACQMNDVKKAILSAKEVKSQFETNPEDKKILAEAKKR
HRPPRHLGIVPEYLMPESMQKEHKPHKVNKAEFEKKLAKRQKREVHDVEEKELMEEIPEN
IAWQDLAPTSNRKLWKIRHHYNMGKRSRKPRRY


>SteCoe_8041(CDS)
ATGGCTGAAAACGAAGAAGGCAACAACTCAAATGCTTACTTGGAAGTCAAAGAAGAAAGT
GATAAGTTTATTATTGTATACACGCTGATCAAACTAGGGTTGATCTCAGGGAAAGTTGTG
ATTTATACTAACACAAAGGATGAAGGATATAAACTTAAACTGTTTCTTGAAGAGTTTCAT
ATAAGAACTTTGATCTTAAGTTACCAGCTTCCAAAAGCAACAAGGCATTTAGTTGTTACC
AACTTCGTCAAAACCAACGATGTGTTAATAGTCATCGACCCTGATGAAAAAGAAAGCGAA
AATAAAGACACAAAAAGACATAAAATCTATAAAGCTGCAATATCAGTACTAATAAACTTC
AATTTCCCATCAAATACACGTCTTTTTAAACGTCGGATTACTGATATTTCTAGTGAACGT
AGTCAGAATTTGTCTTTACTTAGCCTTATCGACCCTAATGAGTTTAAAACTTTTACAAAT
GTTAGTAAAAAGCTTTTAAAACAAGGAAGGATACCTTTTGAGCTTTTAGAAGTGAAAATG
GATCAATTTGAGAAATTTAGGTATAGATGTGAGGATATATTAAAAACAGTGACTGATAAA
AAAATCAAAGCTTGTCAGATGAATGATGTGAAAAAAGCGATTCTATCAGCGAAAGAAGTG
AAAAGTCAGTTTGAAACTAACCCTGAGGATAAGAAAATTCTTGCTGAAGCAAAGAAAAGA
CATAGACCGCCTAGACATTTGGGTATTGTCCCTGAATATTTAATGCCAGAAAGTATGCAA
AAGGAACATAAGCCACATAAAGTTAATAAAGCGGAGTTTGAGAAAAAATTAGCTAAAAGA
CAAAAACGTGAAGTTCATGATGTTGAAGAAAAAGAACTTATGGAAGAAATACCTGAAAAT
ATTGCTTGGCAAGACCTAGCCCCAACATCGAATAGGAAACTATGGAAAATTCGTCATCAT
TATAATATGGGTAAAAGAAGTAGGAAACCTAGAAGATATTAG