Identifiers and Description

Gene Model Identifier

SteCoe_8156

Standard Name

None

Aliases

None

Description

eIF-5a domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_013184301.4251640827409352e-21translation initiation factor
eIF-5A family protein
Saccharomyces CerevisiaeYEL034W3.873997628687187e-21Translation elongation factor
eIF-5A; required for translati
on of proteins containing poly
proline stretches, including B
ni1p, and this leads to a requ
irement for mating projection
formation; structural homolog
of bacterial EF-P; undergoes a
n essential hypusination modif
ication; HYP2 has a paralog, A
NB1, that arose from the whole
genome duplication
Oxytricha TrifallaxContig1970.0.g232.1151310375910805e-19Eukaryotic elongation factor 5
A hypusine, DNA-binding OB fol
d

WormBaseWBGene000020653.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_8156(Protein)
MEHDEEVEVTASGASLTVPSQVGSLKKNGYVLIKDHPCRIVDMSVAKVGKHGSAKAKITG
IDVFTANKYEEIHPTSHNIDVPVITREDWTLVDISRDGYASLMNDAGDTKEDLKVPDDEI
GQKMKALLDGGATVSTTVLRAMGHEKIVDCKEI


>SteCoe_8156(CDS)
ATGGAACACGACGAGGAAGTAGAGGTTACTGCATCCGGAGCTTCTTTAACAGTTCCAAGC
CAGGTCGGCTCCCTGAAAAAGAATGGTTACGTTTTAATCAAGGACCACCCATGCAGAATC
GTCGATATGAGCGTTGCCAAAGTTGGAAAGCATGGTTCAGCCAAAGCTAAAATCACTGGA
ATTGATGTCTTCACTGCTAACAAGTATGAAGAAATCCACCCCACTTCCCATAATATTGAT
GTTCCAGTTATCACAAGGGAAGATTGGACTCTTGTTGATATTTCTAGAGATGGATATGCT
TCTTTGATGAATGATGCTGGAGATACTAAAGAAGACCTTAAAGTTCCTGATGATGAAATC
GGTCAGAAGATGAAAGCCTTACTTGATGGGGGTGCAACAGTTTCCACCACAGTTTTAAGA
GCTATGGGACATGAAAAGATTGTGGACTGCAAAGAAATCTAG