Identifiers and Description

Gene Model Identifier

SteCoe_816

Standard Name

None

Aliases

None

Description

Proteasome_A_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603
  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig13605.0.g111.5007857627073948e-41Proteasome subunit

Saccharomyces CerevisiaeYOL038W4.4737793061811207e-38Alpha 4 subunit of the 20S pro
teasome; may replace alpha 3 s
ubunit (Pre9p) under stress co
nditions to create a more acti
ve proteasomal isoform; GFP-fu
sion protein relocates from cy
tosol to the mitochondrial sur
face upon oxidative stress
WormBaseWBGene000039253.3057006267607343e-37
Tetrahymena ThermophilaTTHERM_006665601.3336148155022614e-3420S proteasome core alpha subu
nit 4

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_816(Protein)
MSGSYDTAITIFSPDGHLFQVEYAMEAVRKGRCVVGMRGKDAVILAVERKAAAKLQDTRT
VKKVYSLDQGIALAFAGLTADARVLCDKARLECQSYRLTMDEAPSSEYVARFIARTQQEY
TQKGGVRPYGVSTLVVGFGKDNQPKLFLTEPSGSFSAWKAHAIGRNSKNVMEFLEKNYTE
ILDTENALKLAVKGLLEVVESGSRNIEVAVMEKEGLRILDDDVVNALIQELEAAP


>SteCoe_816(CDS)
ATGTCAGGATCGTACGACACAGCTATAACAATATTCTCCCCAGATGGGCATCTGTTCCAA
GTAGAATATGCAATGGAAGCTGTGAGAAAAGGACGATGTGTTGTAGGAATGCGTGGTAAA
GATGCAGTTATACTAGCAGTTGAACGTAAGGCTGCGGCTAAGCTTCAAGACACGCGAACC
GTGAAAAAAGTTTACAGTCTAGACCAAGGAATAGCCCTAGCTTTTGCTGGACTGACAGCT
GATGCCAGAGTTCTTTGTGATAAAGCCCGTTTAGAATGTCAAAGCTATAGACTGACAATG
GATGAAGCACCATCATCTGAATATGTGGCAAGGTTTATAGCCCGTACTCAGCAAGAATAT
ACGCAAAAAGGAGGGGTTCGACCTTATGGTGTGTCAACTTTAGTTGTAGGTTTTGGTAAA
GATAACCAGCCTAAACTGTTCTTGACTGAGCCATCAGGAAGCTTCAGTGCATGGAAAGCT
CATGCTATAGGAAGGAATAGTAAAAATGTTATGGAATTTTTAGAGAAAAATTATACAGAA
ATATTGGATACAGAAAATGCGCTTAAACTTGCGGTGAAAGGGTTGTTGGAAGTAGTTGAA
AGCGGAAGTAGAAATATTGAAGTAGCTGTTATGGAAAAGGAAGGACTGAGAATTTTAGAT
GATGATGTAGTCAATGCCTTGATTCAGGAATTAGAAGCTGCACCTTAG