Identifiers and Description

Gene Model Identifier

SteCoe_819

Standard Name

None

Aliases

None

Description

RRM_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig11888.0.g74.248354255291589e-18PWI domain

Tetrahymena ThermophilaTTHERM_000239200.0000000001026187963170189RNA recognition motif-containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_819(Protein)
MFGYQTPLSAQLHGSHIISANPTIQGPRGLFNITSTPLTTIHQIATPGDMLGMPLPSDEP
RTKSERSTKVYIGKIPGSLSDYFMEQLFLECGHINSWRRILDSSGKPLNFGFVEFTYVEG
MLRCLRMMNNLQIQNSKLVCRVDTQTEFFIKEWSDLKRADWERKRWDNIMDNVDLSCKTW
EEEVVKDDVKISQNLQSIINNFEQHAGNDPEEREDDKEHQREKDREKRIKSKNRDRERQL
KEREKEYLRKEELKEKERAKDREKEEEKERERIKMLRKDLEYSSSDEETLKQKYSKKYEK
NRQERAKQREKEKEEDQVNARKEFELMFPGVATAEEKLKQAEEIEQKRRENEEEYQLGEH
KDIEIKVNLNDEPKIAPKPLNKNFGAQEEEEEDPLYKRTHKPLELPAIFEEIPKPVPQPE
IIMNEETYNTKLKNYKNLLEKVPRKRKELYAFTLSWNALAQNRILEKKLGPFISKLFVEY
VGEDDRNLVQMITRMVVNRDDPDKIEKIVAKFLEEEAQVIFK


>SteCoe_819(CDS)
ATGTTTGGTTATCAAACCCCACTAAGTGCCCAATTACATGGATCTCATATAATCTCAGCT
AATCCTACAATACAAGGTCCTCGAGGTTTATTTAATATAACCAGCACCCCTCTAACAACT
ATTCATCAAATTGCAACCCCTGGGGATATGCTTGGTATGCCTCTTCCATCAGACGAACCT
AGGACTAAGTCAGAAAGATCGACTAAAGTTTATATAGGAAAAATCCCAGGTAGCCTTAGT
GATTACTTTATGGAACAACTTTTCTTAGAATGTGGGCATATAAATTCATGGCGTCGAATC
TTAGACTCATCAGGTAAACCTTTAAATTTCGGCTTTGTAGAATTTACTTATGTTGAAGGA
ATGCTTAGATGCTTAAGAATGATGAACAATTTACAAATACAAAATTCTAAACTTGTATGC
CGAGTTGATACACAGACTGAATTTTTCATTAAAGAATGGAGTGATTTAAAAAGGGCTGAT
TGGGAAAGAAAAAGGTGGGATAATATCATGGATAATGTTGATTTATCATGTAAAACATGG
GAAGAAGAAGTTGTTAAAGATGATGTAAAAATATCCCAAAACCTTCAATCTATAATAAAT
AATTTTGAACAACATGCTGGTAATGATCCAGAAGAACGAGAAGATGATAAAGAACATCAA
AGAGAAAAAGATAGGGAAAAAAGGATTAAATCTAAAAACCGAGATCGTGAACGACAACTT
AAAGAAAGGGAAAAAGAGTATTTAAGAAAAGAAGAATTAAAAGAAAAAGAAAGGGCTAAA
GATAGAGAAAAAGAAGAGGAAAAAGAACGTGAAAGGATTAAAATGCTTAGAAAAGATTTG
GAGTATAGCTCAAGTGATGAAGAAACTTTAAAGCAAAAATACAGTAAAAAATACGAAAAA
AATCGACAGGAAAGAGCAAAACAACGAGAAAAAGAAAAAGAAGAAGACCAAGTTAATGCG
AGAAAAGAGTTTGAGCTTATGTTCCCTGGTGTTGCTACAGCTGAAGAAAAACTTAAACAA
GCTGAAGAAATCGAACAGAAACGACGTGAAAATGAAGAAGAATATCAACTAGGTGAGCAT
AAAGATATAGAAATCAAAGTAAATTTGAATGATGAACCAAAAATTGCCCCTAAGCCTTTA
AATAAAAACTTCGGAGCTCAAGAGGAAGAAGAAGAAGACCCGTTATATAAAAGGACTCAT
AAACCTTTAGAACTCCCTGCAATATTTGAAGAAATTCCTAAGCCTGTACCACAGCCAGAA
ATCATTATGAATGAAGAAACTTATAATACAAAACTTAAAAACTATAAAAATTTACTTGAA
AAAGTTCCAAGAAAACGTAAAGAACTTTATGCTTTTACCCTTTCATGGAATGCTTTAGCC
CAAAATCGTATATTGGAAAAAAAATTAGGTCCGTTTATTTCTAAGCTTTTTGTTGAATAC
GTTGGTGAAGATGATAGAAATTTGGTTCAAATGATAACGAGAATGGTTGTTAATAGAGAT
GATCCAGATAAAATAGAAAAAATTGTTGCGAAATTTTTAGAAGAGGAAGCACAGGTAATA
TTTAAATAG