Identifiers and Description

Gene Model Identifier

SteCoe_8212

Standard Name

None

Aliases

None

Description

DEAD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_002191801.3485799642996046e-77DEAD/DEAH box helicase family
protein
Oxytricha TrifallaxContig1255.1.g184.020060215743355e-74DEAD/DEAH box helicase

Saccharomyces CerevisiaeYJL033W3.5722699376192174e-67DEAD box RNA helicase; compone
nt of the SSU; interacts with
Bfr2p and Enp2p; high-copy num
ber suppression of a U14 snoRN
A processing mutant suggests a
n involvement in 18S rRNA synt
hesis
WormBaseWBGene000212771.1677812485237086e-60

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_8212(Protein)
MKKPYKRPAFYQSKSLEKRIKIETPDTGVVPVGKDSCSADLLKYEFSELPISKNTIRALT
ENDWHTMTPIQRGSIPHILAGRDVLGTALTGSGKSLSFLVPMLENLYRQKWSSIDGLGAL
IIAPARELGIQLFETLNKVGRYHNFSAGLIIGGKDIKYEQISIASINILIATPGRLLQHL
QETPDFNLDNLKMLIIDEADRILEMGFEESLNLILEYLPLTRQTVLFSATLSKSLRELSR
LSLSEYEYINVLPNKDEMAIKKKLSQYYIEVDLQNKFNLLFSFLKTHLHHKTIVFLSSCK
QVRFVYESFKMLHPGIQIMEIHGKQKQSKRTAIYYAFMEKTEAVLFCTDIAARGLDFPLV
HWVVQVDCPEDVESYVHRIGRTARYKSGGNGVIFLLPSEIKFLELLGKKNIQVKKLTPNP
SKTYNITGSLQGIVAEYHDIKHLAERAFVSYVRSIFLMPNKEIFNIQGLPLKEFAESFGM
VSVPEVNVVKVEPHTMTKLEKLKQKIKAIKLAKQGLTTSTDPEEDLFKVKSESVQIPEEF
LPQVDKSETNIKRSLNIPFSEGKEDISQRLIYKAKNSQYQSLVDEKNRKKASKIKAKETE
RERLTYLEESDEN


>SteCoe_8212(CDS)
ATGAAAAAACCGTACAAGAGACCAGCATTTTACCAATCCAAATCCCTTGAAAAAAGGATA
AAAATTGAAACTCCCGATACCGGTGTGGTTCCAGTAGGTAAAGACTCTTGTTCTGCTGAT
CTTCTTAAATACGAGTTTTCAGAGCTCCCAATATCAAAAAACACAATAAGAGCCTTAACA
GAAAATGATTGGCATACAATGACCCCAATCCAACGTGGTTCAATACCCCATATTTTAGCT
GGTCGAGATGTTCTTGGTACAGCCCTAACAGGTTCAGGTAAATCCTTATCTTTTTTAGTG
CCAATGCTAGAAAATCTCTACCGACAAAAATGGTCAAGTATCGATGGTTTAGGTGCTCTT
ATAATAGCCCCAGCTCGTGAACTTGGTATCCAACTCTTTGAAACCTTAAACAAAGTAGGC
AGATATCACAATTTTTCTGCAGGGCTGATTATTGGTGGTAAAGATATAAAATATGAACAA
ATTAGCATAGCTTCAATCAATATCCTCATAGCAACACCTGGAAGACTTCTTCAACACCTT
CAAGAAACTCCAGATTTCAATTTAGACAATTTGAAAATGCTTATAATAGATGAAGCGGAT
AGGATATTAGAAATGGGGTTTGAAGAAAGTTTAAATTTGATACTTGAGTATTTACCTCTT
ACAAGACAGACTGTGTTATTTTCAGCAACACTTTCGAAATCATTACGTGAGTTGTCTAGG
CTTTCACTTAGTGAATATGAGTATATTAATGTTTTACCTAACAAAGATGAGATGGCTATT
AAGAAAAAACTTAGTCAGTATTATATTGAAGTTGATTTACAGAATAAGTTTAATTTGCTT
TTTTCGTTTTTGAAGACTCATTTGCATCATAAAACTATTGTTTTTTTAAGTTCTTGTAAG
CAAGTGAGGTTTGTTTATGAGAGTTTTAAGATGCTGCATCCGGGAATACAGATTATGGAA
ATACATGGTAAACAGAAACAATCGAAAAGGACTGCAATTTATTATGCGTTTATGGAGAAA
ACGGAGGCTGTGCTGTTTTGCACGGATATTGCTGCTAGAGGACTGGATTTCCCTTTGGTT
CATTGGGTTGTACAAGTTGACTGTCCTGAAGATGTTGAGAGTTATGTGCATAGAATTGGC
AGGACGGCAAGATATAAGTCTGGTGGAAATGGGGTTATTTTTTTGTTGCCTTCAGAGATA
AAGTTCTTAGAATTACTTGGCAAAAAGAATATTCAGGTTAAAAAACTTACTCCGAATCCT
AGTAAGACTTATAATATTACAGGAAGTTTGCAAGGGATTGTTGCGGAGTATCATGATATT
AAGCATTTAGCAGAAAGAGCTTTTGTATCGTATGTGAGGAGTATATTTTTGATGCCAAAT
AAAGAAATTTTTAATATACAAGGTTTGCCGCTGAAGGAATTTGCTGAGTCATTTGGAATG
GTTAGCGTGCCTGAAGTCAATGTTGTTAAGGTTGAGCCACATACAATGACAAAACTAGAA
AAACTCAAACAAAAAATCAAAGCAATAAAACTTGCCAAACAAGGCTTAACAACTTCTACT
GACCCTGAAGAAGATCTTTTCAAAGTTAAATCTGAGTCCGTACAAATCCCTGAAGAGTTC
CTTCCGCAAGTTGATAAATCTGAAACTAATATAAAAAGATCTTTGAATATACCATTTAGT
GAAGGTAAAGAAGATATATCTCAAAGACTGATTTACAAAGCTAAAAACTCTCAATATCAA
AGCCTTGTAGATGAAAAAAACAGGAAAAAAGCTAGTAAAATCAAAGCTAAAGAAACTGAA
CGTGAACGTTTAACGTATCTTGAAGAAAGTGACGAAAATTAG