Identifiers and Description

Gene Model Identifier

SteCoe_8302

Standard Name

None

Aliases

None

Description

zf-met domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig15681.0.g151.0112214926104486e-43Zinc-finger of C2H2 type

WormBaseWBGene000086836.054601895401186e-39
Tetrahymena ThermophilaTTHERM_003436801.2160992992528256e-37spliceosome associated protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_8302(Protein)
MDMQNRAGAKAGGGGIASQAMINAERRERQRRLAMEASDISKDPFFMKNHLGTFECRLCL
TLHTNESSYLAHTLGRKHQANLVRRKCREGKDIAVFPQPKSRIVSKRIIKIGRPGYRVTK
QNDPMTSQKSLLFEIEYPEIDQTIKPRHRIMSCYEQNREPVNDKFQYVLFAADPYEIIAF
KVPNLRIDSSEGKYYCNWDEIKKVYTVQLTFKDN


>SteCoe_8302(CDS)
ATGGACATGCAAAATCGTGCTGGCGCCAAAGCTGGAGGTGGTGGGATAGCTTCACAAGCT
ATGATAAATGCTGAAAGAAGAGAAAGACAGAGAAGGCTAGCAATGGAAGCTAGTGACATA
TCGAAAGACCCTTTTTTTATGAAAAATCATCTTGGGACTTTTGAATGTCGTCTTTGTTTG
ACTCTTCATACAAATGAAAGCAGTTATTTGGCTCATACATTAGGAAGAAAGCATCAAGCT
AATTTGGTTAGACGTAAATGCCGAGAAGGAAAAGATATTGCCGTGTTTCCACAACCTAAA
AGCCGAATAGTTTCTAAGAGGATTATAAAAATTGGTCGGCCTGGGTATAGGGTTACAAAG
CAAAATGACCCGATGACTAGTCAGAAATCATTACTTTTTGAAATTGAGTATCCAGAAATT
GATCAGACTATTAAACCTAGGCATAGGATTATGTCTTGTTATGAGCAAAATAGAGAACCA
GTCAATGATAAGTTCCAGTATGTTCTTTTTGCTGCTGACCCTTATGAGATTATAGCTTTT
AAAGTGCCGAATTTGCGAATTGACTCTTCAGAAGGTAAGTACTACTGCAATTGGGATGAG
ATTAAAAAAGTTTACACAGTTCAGCTGACTTTTAAGGACAATTAG