Identifiers and Description

Gene Model Identifier

SteCoe_8397

Standard Name

None

Aliases

None

Description

MORN domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12851.0.g832.0842828425817514e-52MORN repeat

Tetrahymena ThermophilaTTHERM_007664904.1863939993042314e-51protein with predicted MORN do
mains localized at the C-termi
nus of the protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_8397(Protein)
MGTACTCLKEYTAEENQMTIEKEEIAIKSSGKSSTHIRTSSNFPKNSVGDVIKIQSILRG
YIERKQVREIVNKVIAFKPLAVVSTQKLLIQTTEDLPNYSNPATLAAERRCGPFVYLARD
DDGVKVTAKNAVNLENGAVYIGEWNILNERHGRGMQLWNDGSKYEGYWKNGKANGRGRLI
HGDGDVYEGEWKDDKAHGYGTYIHTDGAKYEGMWIDDKQYGMGHETWPDGSKYSGQYVNG
RKQGKGNFIWSDGSTYEGEFYENDINGNGIYKWNDGRKFEGSWKNNKMDGKGVFEWPDGR
KYNGEYIDDKKQGFGIFEWPDGKKYEGFWLDGKQHGTGVFYNSNGEKKEGVWKEGRRVKN
IE


>SteCoe_8397(CDS)
ATGGGAACAGCATGCACATGTCTGAAAGAATATACAGCAGAAGAAAATCAAATGACCATA
GAAAAAGAGGAGATTGCAATAAAAAGTTCAGGAAAAAGCTCAACTCATATTAGGACTTCA
TCTAATTTTCCAAAAAACAGCGTAGGTGATGTGATCAAAATTCAATCAATACTTAGAGGA
TACATCGAGAGGAAACAAGTAAGAGAAATAGTAAATAAAGTTATAGCTTTCAAGCCTCTA
GCAGTAGTTTCAACTCAAAAGCTTTTAATCCAAACTACTGAAGATTTACCAAATTATTCA
AATCCAGCAACCCTAGCTGCAGAAAGAAGGTGTGGACCTTTTGTATACCTGGCCCGAGAT
GATGATGGAGTTAAAGTTACAGCAAAGAATGCAGTGAACTTAGAAAACGGAGCAGTTTAT
ATTGGAGAATGGAATATTTTAAATGAACGACATGGTCGGGGGATGCAGCTGTGGAATGAT
GGGTCTAAGTACGAAGGCTATTGGAAAAATGGGAAAGCAAATGGAAGAGGTCGACTTATT
CATGGAGATGGAGACGTTTATGAAGGCGAATGGAAAGACGATAAAGCTCATGGCTATGGT
ACTTATATACATACAGATGGGGCTAAATATGAGGGAATGTGGATAGATGATAAGCAATAT
GGAATGGGACATGAAACTTGGCCTGATGGATCTAAATATAGTGGGCAGTATGTAAATGGT
CGTAAGCAAGGTAAAGGGAATTTCATTTGGTCAGATGGAAGTACATATGAAGGTGAATTT
TATGAAAATGATATTAATGGAAATGGAATTTACAAATGGAATGATGGTAGGAAGTTTGAA
GGAAGCTGGAAGAATAATAAGATGGATGGCAAGGGAGTTTTCGAGTGGCCTGATGGCCGC
AAGTATAATGGTGAGTATATTGATGACAAAAAGCAGGGATTTGGGATTTTCGAATGGCCA
GACGGAAAAAAATATGAAGGGTTTTGGCTAGATGGGAAGCAGCATGGTACGGGAGTTTTT
TATAACTCAAATGGGGAGAAAAAAGAAGGAGTATGGAAAGAAGGTAGAAGGGTTAAAAAT
ATAGAATAA