Identifiers and Description

Gene Model Identifier

SteCoe_8486

Standard Name

None

Aliases

None

Description

Ribosomal_S19e domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig11050.0.g682.8625185805493937e-20Ribosomal protein S19e

Tetrahymena ThermophilaTTHERM_008236701.1548224173015786e-17Homolog of yeast RPS19, human
RPS19;
Saccharomyces CerevisiaeYNL302C0.000000000000001713908431542013Protein component of the small
(40S) ribosomal subunit; requ
ired for assembly and maturati
on of pre-40 S particles; homo
logous to mammalian ribosomal
protein S19, no bacterial homo
log; mutations in human RPS19
are associated with Diamond Bl
ackfan anemia; RPS19B has a pa
ralog, RPS19A, that arose from
the whole genome duplication
WormBaseWBGene000044880.00000000000009357622968840175

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_8486(Protein)
MDKKALVVKDVSASAFISEYAAYLKRTDKITIPSWVDYVKTGSGKQLAPYDKDWLYIRAA
ALARKVYLRPNIGVGALKKEFGCSKNYGTTPCHFVQGSGKIIRYLMKELEDKGIIETIKD
EDNDQRTIGRKITQKGQQELDSIARQIKV


>SteCoe_8486(CDS)
ATGGACAAAAAAGCTTTAGTTGTTAAAGACGTGTCAGCCTCTGCCTTCATATCAGAATAT
GCAGCTTATCTTAAAAGAACAGATAAGATTACAATTCCAAGTTGGGTAGATTATGTCAAA
ACAGGTTCTGGAAAACAATTAGCTCCATATGATAAAGACTGGCTTTATATACGTGCAGCA
GCTTTAGCAAGAAAAGTTTATTTAAGACCAAATATTGGTGTAGGAGCATTGAAAAAAGAG
TTTGGATGCTCAAAAAACTATGGAACAACCCCATGTCACTTTGTCCAAGGATCAGGGAAA
ATTATTAGATATCTTATGAAAGAACTTGAAGATAAAGGGATTATTGAGACTATCAAAGAT
GAAGATAATGACCAAAGGACAATTGGTAGAAAAATTACTCAGAAAGGTCAGCAGGAACTT
GATAGTATTGCTAGGCAGATTAAAGTTTAG