Identifiers and Description

Gene Model Identifier

SteCoe_8516

Standard Name

None

Aliases

None

Description

eRF1_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000202690
Oxytricha TrifallaxContig21968.0.g121.8251045143570802e-78eRF1 domain 2

Tetrahymena ThermophilaTTHERM_002921705.96629836401057e-72Eukaryotic release factor 1; b
elieved to recognize the stop
codon of mRNA and terminate tr
anslation; gene has 4 introns;
deduced protein sequence 57%
similar to human eRF1; domain
1 proposed to be the codon rec
ognition site

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_8516(Protein)
MEGQDELEKNIELWKVKRLIQSLERARGNGTSLISLIIPPKEQLPLINKMITEEYGKAAN
IKSRVVRQAVQSALTSVKERLKLYNNRVPLNGLIVYCGEVINEEGVCEKKYTFDLQPFRP
INTSLYLCDNKFETSVLKELLETDDKFGFIIVDGNGALFGTLQGNTREILHKFSVDLPKK
HRRGGQSSVRFARLRMESRHNYLRKVAEAATQMFITNDRANVTGLILAGSAEFKKDLYVS
DMFDQRLQPKVVNIVDIAYGGENGFNQAIELSAETLLNVRFIREKKIVGKFFEEVSLDSR
KYCYGVNDTIRALTMGAIETILLFEGLENIRVVLRNPNNQTEKILYLTLEEEKKNEHYME
NGVELECIDKSPLAEWIVENYTKFGATLEFVTDKSQEGMQFVRGFGGIGGFLRYQLEVGE
FGEDEVLDEEWDDDFM


>SteCoe_8516(CDS)
ATGGAAGGTCAAGATGAGCTTGAGAAGAATATTGAACTTTGGAAAGTGAAAAGACTCATC
CAGAGCCTTGAAAGAGCCAGAGGAAATGGAACTTCTCTAATCTCACTTATAATTCCTCCC
AAAGAGCAGCTACCTTTAATCAACAAAATGATAACAGAAGAATACGGCAAAGCTGCTAAC
ATTAAATCCCGTGTTGTCCGCCAAGCAGTCCAAAGCGCTTTAACTTCAGTAAAAGAACGT
CTTAAGCTTTACAATAACCGAGTTCCTTTAAATGGCCTTATAGTTTACTGTGGTGAAGTT
ATAAATGAGGAAGGAGTTTGTGAGAAAAAATACACTTTTGACCTTCAGCCATTTAGACCA
ATAAATACATCACTTTATCTCTGTGATAATAAATTCGAAACATCAGTATTAAAAGAACTC
TTAGAAACTGATGATAAATTTGGGTTTATTATAGTTGATGGTAATGGAGCCCTTTTTGGT
ACACTTCAAGGAAATACCAGAGAAATTCTTCATAAATTCTCAGTAGACTTACCAAAAAAA
CATAGAAGAGGAGGACAATCAAGTGTTCGTTTTGCAAGACTTAGGATGGAATCAAGACAT
AATTATTTGAGAAAAGTTGCTGAAGCTGCTACTCAGATGTTTATTACTAATGATAGGGCA
AATGTTACAGGATTGATTTTAGCAGGAAGCGCAGAGTTTAAAAAAGATTTATATGTTAGT
GATATGTTTGATCAAAGATTACAACCTAAAGTTGTTAATATTGTCGATATTGCCTATGGA
GGAGAAAATGGGTTTAATCAAGCTATTGAGTTAAGTGCTGAAACTTTATTAAATGTTAGG
TTTATTCGTGAGAAAAAAATTGTTGGGAAATTCTTTGAAGAAGTTTCATTAGACTCTAGA
AAATATTGTTATGGGGTTAATGATACAATTCGTGCTTTGACAATGGGTGCTATTGAAACT
ATTTTGCTTTTTGAAGGTTTAGAGAATATTAGAGTTGTCCTTCGCAATCCAAATAATCAA
ACTGAAAAGATTTTGTATTTGACTTTAGAAGAGGAGAAGAAAAATGAACATTATATGGAA
AATGGAGTTGAGTTAGAATGTATAGATAAAAGTCCATTAGCTGAATGGATTGTTGAAAAC
TATACAAAATTTGGTGCTACATTGGAATTTGTTACTGATAAAAGTCAAGAAGGCATGCAG
TTTGTAAGAGGTTTTGGGGGTATTGGAGGCTTTTTAAGATACCAATTAGAAGTTGGAGAG
TTTGGAGAAGATGAGGTGTTAGATGAAGAATGGGATGATGATTTTATGTAG