Identifiers and Description

Gene Model Identifier

SteCoe_8610

Standard Name

None

Aliases

None

Description

DEAD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig7238.0.g672.2856936767186716e-49DEAD/DEAH box helicase

WormBaseWBGene000171621.6889118802245324e-48
Tetrahymena ThermophilaTTHERM_009916205.0345753587649823e-45DEAD/DEAH box helicase family
protein
Saccharomyces CerevisiaeYNL112W5.380186160021138e-32ATP-dependent RNA helicase of
the DEAD-box protein family; h
as a strong preference for dsR
NA; interacts with YRA1; requi
red for the assembly of Yra1p,
Nab2p and Mex67p onto mRNA an
d formation of nuclear mRNP; i
nvolved in mRNA decay and rRNA
processing; may be involved i
n suppression of transcription
from cryptic initiation sites

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_8610(Protein)
MQEEKFKPVFLSKDERLKLKSTLPQPEIKSTIIPVRSRSPDRIENAKFEKPKQKVLDLLK
YRQTFRFEWDNADDTGKEISNDSFRVIPAPLKGRTSTKSQNSLKKSDLITKPIQNMSSRD
WKIFKENFYITCKSDILPIRNWEESELDRKLIRALRKLEYNYPTAIQMQAIPISIQRHDL
IGLSHTGSGKSAAYLLPLVNHLMKLPKLDYDTNQDGPYALVISPTRELALQIVDECEGII
KYAEIRVYGIVGGKSVEEQGMELRKSTEIVIATPGRLLELLQMQYLVFNQCRWIIIDEAD
KIILLEQEETMREIFTFFPQESWKSTNSSVFTVQQAENFRSNITMQIFSATMDAQIESMW
RAYLKNPITVQITDTTKKIAQKFYFIEEGNKKNTLKNVLKDLTPPILIFMNEKVEADNLT
NFLNYRWKASCLHGGKTQDIRETVMEKFREGRIDILISTDVVSRGINLKHLKYVINYDCP
KSIIDYEHRIGRTGRMGKKGTAITFITTENYPLLPQISNFLKKIGQKVPQELEKQLENLK
ETETITQ


>SteCoe_8610(CDS)
ATGCAAGAAGAAAAGTTTAAGCCTGTTTTCCTATCAAAAGATGAGAGACTAAAACTAAAA
AGCACTTTGCCACAGCCAGAAATTAAGTCTACAATAATACCTGTAAGGTCTCGATCTCCA
GACAGGATAGAAAATGCTAAGTTCGAGAAGCCAAAACAAAAAGTACTTGATTTACTAAAA
TATAGGCAAACTTTTCGTTTTGAATGGGACAACGCAGATGATACAGGTAAAGAAATTTCA
AATGACTCATTCCGTGTAATTCCAGCACCACTTAAAGGTCGTACTAGTACAAAATCGCAA
AATTCTTTAAAAAAATCAGACCTTATAACCAAACCAATACAAAACATGTCATCAAGAGAC
TGGAAAATATTCAAAGAAAACTTTTATATAACATGTAAAAGCGATATACTTCCAATAAGA
AACTGGGAAGAATCTGAACTTGATAGGAAACTTATAAGAGCTTTAAGGAAATTAGAATAC
AATTACCCTACAGCAATACAAATGCAAGCGATACCAATTTCTATACAAAGACATGATCTT
ATAGGTCTGTCACATACTGGAAGTGGAAAAAGTGCTGCTTATTTGCTTCCATTAGTAAAT
CATCTAATGAAACTTCCTAAATTGGATTACGATACAAACCAAGATGGTCCTTATGCTCTT
GTAATATCCCCTACAAGAGAACTTGCCCTACAAATTGTCGATGAATGTGAAGGGATAATA
AAATATGCAGAAATAAGGGTCTACGGGATTGTTGGAGGGAAAAGTGTAGAGGAACAAGGG
ATGGAATTACGTAAAAGTACTGAAATCGTCATTGCGACACCTGGTAGACTACTAGAATTG
CTTCAAATGCAATACTTAGTTTTCAATCAATGCCGTTGGATTATTATCGATGAAGCTGAT
AAAATTATTTTACTTGAACAAGAAGAGACTATGCGAGAAATTTTTACATTTTTCCCACAA
GAGTCTTGGAAGTCAACAAATTCTTCAGTTTTTACAGTTCAACAAGCTGAAAATTTTAGA
TCAAATATAACAATGCAAATATTTTCTGCTACTATGGATGCGCAAATTGAAAGCATGTGG
AGAGCATATTTAAAAAATCCAATTACGGTACAAATTACTGACACAACAAAGAAAATTGCC
CAGAAATTTTATTTTATTGAAGAAGGTAATAAGAAAAATACATTAAAAAATGTGTTGAAA
GATTTAACCCCGCCGATATTGATTTTTATGAATGAAAAAGTTGAAGCGGACAACCTGACA
AATTTTTTGAATTATAGATGGAAAGCATCTTGCTTGCATGGAGGTAAAACACAAGATATA
AGAGAAACAGTGATGGAAAAATTCCGTGAAGGTCGAATAGATATACTTATAAGCACAGAT
GTAGTAAGTCGTGGGATAAATCTTAAACATCTAAAATACGTTATCAATTATGACTGCCCA
AAAAGTATCATAGACTATGAACACCGAATAGGACGAACAGGGCGAATGGGTAAAAAAGGT
ACTGCAATAACATTCATCACAACAGAAAACTACCCTTTGCTCCCTCAAATAAGTAATTTT
CTCAAAAAAATTGGTCAAAAAGTTCCTCAGGAACTTGAGAAACAGTTAGAAAACCTTAAA
GAAACTGAAACTATTACTCAATAG