Identifiers and Description

Gene Model Identifier

SteCoe_8646

Standard Name

None

Aliases

None

Description

ABC_membrane domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006833503.665820411179563e-77ABC transporter family protein
Oxytricha TrifallaxContig7364.0.0.g833.5722699376192174e-67ABC transporter

Saccharomyces CerevisiaeYDR135C3.917469664450395e-64Vacuolar glutathione S-conjuga
te transporter; ABC-C transpor
ter of the ATP-binding cassett
e family; required for vacuole
fusion; forms stable complexe
s with vacuole fusion machiner
y; regulates Vam7p recruitment
to vacuoles; role in detoxify
ing metals (Cd, Hg, As); trans
ports GSSG that is not immedia
tely reduced in cytosol to vac
uole; transports unconjugated
bilirubin, selenodigluthatione
, oxidized glutathione; simila
r to human cystic fibrosis pro
tein CFTR
WormBaseWBGene000034143.917469664450395e-64

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_8646(Protein)
MDNPVEYATFPYDEASWFDDLFLRWVFPMAKYFRSKPPSMENMIKLPDRLHYDDNFKKVN
KAWKKESLNKNPNIFNALWTVLKKEYLLANLPGIISYNFMILSSLMIVYIVNYINNNNEP
VSHIVGYIIAYSIFVMIISLGINRSFIMCYFFTAKLKGILTQMIFEKSLKTYLGEISQGD
QIGKITSLVSADVEFFEGLVIMPFFFAMPTFFIGSGILLGFNLGASGIVGLLVAIFHFPL
IYYFGKVIGKYRYLTSAIGDARMKMITNLIEGIRIVKLYGWEHPYLESLFNKRQLEINQY
KKKALVSCFYKSINYGSMGLVLFVTFSMYIALGNKLEAGTSFSSIAILILCTSMVSLIGT
AGIMQVFLLIIAMKRITQSLLMQERTKIEFETCSEKYSLQVRHCTFMWKEPEKTKNDESE
MSTIRESKTIWSLNNLNFKCKPGELIIVIGSVGSGKSALFMGLLREIFLAEGEVKANGRI
SLASEEPWIISGTIKQNILMGLGMDEEWYDKVTTGCCLDKDFEQFNEYRDETIVGDRGIT
LSGGQKARVSLARAVYANREIILLDDPLSAVDPEVCSKLFHDCIKGVLADKTVILATHQA
HFVSHADKVMILDDGKQIFFGTYEELIEGGFSSYLGKLSQNKKAADEEVVKKIETKEYKR
SATQDIKSIQVEERAKGNVPFKIYWRFLMFGYYNWFIILLCTLLQCAAQVSYLSIIYWIA
YWSSAPDQENSKYILGMGILVIILYIFTFFRTYVMNFPLIKSSQKLHNQALSGLAYTKSV
FFDQNPTGRMLNRFSKDTSLMDETLVMTLGECVTTFTLVFGNFIVIVIINPYILIALAVM
VTYFIILTRYLARINKDLKVLDLTTKSPIISLLNTSIHGLSTIRCLDLSHRLKREMRSSI
GENLKSYISFQVIFRGIQMYLDIGPNIMNVVNIIVLVLIKDTMTPGLAGMSISLTITIMG
YVGYLFRIGIDTDNNMASPQRLFEYQKLEPEGDHIKDGSFKISKGKIEVRELYMKYRENY
DFALKGLNFTIQPGMKTGIIGRTGAGKSSIMQVLFRLTNPQQGTIFIDGQDYLKAGLHEL
RKQMSVIPQTATLFIASLKDNLDPFHEHSDDEIKKVLGKVRLGGLLDHLPKGLESQINSK
GLSLSAGQKQLVCLARAILRRNKIVMIDEATANVDSETDEFIQSQLMKRFKNSTLLIVAH
RLRTVIESDWMVVMDEGKTLQEGHPRDLIKEPDSLLMKMIKHTGQEESEYLLSKLVTIG


>SteCoe_8646(CDS)
ATGGATAATCCTGTGGAATACGCTACTTTCCCATACGATGAAGCGAGCTGGTTTGATGAT
CTTTTCCTAAGATGGGTCTTCCCAATGGCAAAGTACTTTAGATCAAAGCCTCCAAGTATG
GAAAACATGATTAAATTACCAGATAGACTACATTACGATGATAATTTTAAAAAAGTAAAT
AAAGCTTGGAAGAAAGAAAGCTTAAATAAAAACCCCAACATTTTCAATGCCCTTTGGACT
GTTCTCAAAAAGGAATATCTTTTAGCTAACCTTCCAGGAATTATTAGTTACAATTTTATG
ATTCTGTCATCATTAATGATTGTATATATTGTCAACTATATAAACAACAACAATGAACCT
GTTTCACATATAGTCGGCTATATTATAGCTTATTCGATTTTTGTTATGATTATCAGTTTA
GGAATCAATAGATCTTTTATTATGTGTTACTTTTTTACAGCGAAACTTAAAGGGATTTTG
ACACAAATGATTTTTGAAAAAAGCTTGAAAACTTATCTTGGGGAAATATCACAAGGAGAT
CAAATTGGAAAAATTACAAGTTTAGTATCGGCTGATGTTGAGTTTTTTGAAGGGTTGGTT
ATTATGCCATTTTTCTTTGCTATGCCTACTTTTTTTATAGGCTCAGGGATTTTGCTTGGG
TTCAATTTAGGAGCATCAGGGATTGTTGGGTTGCTGGTTGCTATATTTCACTTTCCTTTG
ATTTATTATTTTGGTAAAGTTATAGGCAAGTACAGATATTTAACTTCGGCAATTGGTGAT
GCTAGAATGAAAATGATAACAAATCTTATTGAGGGTATAAGAATTGTAAAGCTTTATGGC
TGGGAACATCCTTACCTTGAAAGTCTTTTCAACAAACGGCAATTGGAAATTAATCAATAC
AAAAAAAAAGCTCTTGTTAGTTGTTTTTACAAATCTATAAACTATGGTTCTATGGGACTT
GTTCTTTTTGTAACTTTTTCTATGTACATAGCATTAGGTAATAAGCTTGAAGCTGGCACA
TCATTTAGTTCTATAGCTATACTAATATTATGTACAAGTATGGTAAGTCTTATTGGAACA
GCAGGTATAATGCAAGTGTTTCTTTTAATAATTGCTATGAAAAGAATAACTCAATCGCTT
TTAATGCAAGAAAGGACTAAAATCGAATTTGAAACATGCTCTGAAAAATATTCTTTACAA
GTCAGACACTGTACTTTTATGTGGAAAGAACCTGAAAAAACTAAAAATGATGAAAGTGAA
ATGTCGACTATAAGAGAAAGTAAAACAATCTGGAGTCTTAATAATTTGAATTTCAAATGC
AAACCTGGAGAACTTATAATAGTTATCGGATCAGTTGGTTCAGGAAAATCAGCTCTTTTT
ATGGGTCTTCTAAGAGAAATCTTTTTAGCAGAAGGAGAAGTTAAAGCAAATGGGAGAATT
TCTCTAGCAAGTGAAGAACCTTGGATAATATCTGGAACAATAAAACAAAACATACTAATG
GGTCTTGGTATGGATGAAGAATGGTATGATAAAGTTACAACAGGTTGTTGTCTTGATAAA
GATTTTGAACAATTTAATGAATATAGAGATGAAACTATTGTTGGAGATAGAGGTATAACT
TTAAGTGGAGGACAAAAAGCTAGAGTTTCATTAGCAAGAGCTGTTTATGCTAATAGAGAA
ATAATATTATTAGATGATCCATTAAGTGCTGTTGATCCAGAAGTATGTTCGAAGCTATTT
CATGATTGTATTAAAGGTGTTTTAGCTGATAAGACAGTAATTTTAGCAACACATCAAGCG
CATTTTGTATCACATGCTGATAAAGTTATGATACTTGATGATGGAAAACAGATATTTTTT
GGGACTTATGAAGAACTTATTGAGGGAGGATTTTCTTCATATTTAGGGAAATTGAGTCAA
AATAAAAAAGCTGCTGATGAAGAAGTTGTGAAAAAAATAGAGACTAAGGAATACAAAAGA
TCTGCAACACAAGATATTAAATCTATACAAGTTGAAGAAAGGGCAAAAGGAAATGTACCT
TTTAAGATTTATTGGAGATTTTTGATGTTTGGTTATTATAATTGGTTTATTATTTTATTA
TGTACATTGCTGCAATGTGCTGCTCAAGTATCATATTTGTCTATTATATATTGGATTGCA
TATTGGTCATCTGCACCTGATCAAGAAAATTCCAAATATATACTCGGAATGGGTATTTTA
GTTATAATTCTTTACATATTCACATTTTTCAGAACATATGTTATGAATTTCCCACTAATA
AAATCCTCTCAAAAACTTCATAATCAGGCTCTTTCTGGACTGGCATATACAAAAAGTGTA
TTTTTTGATCAAAATCCTACAGGTCGAATGCTTAATAGATTCTCAAAAGATACATCTTTA
ATGGATGAAACACTTGTTATGACTCTTGGAGAATGTGTAACAACATTCACTTTAGTCTTT
GGGAATTTTATTGTCATAGTTATTATAAACCCTTATATTCTTATAGCTTTGGCAGTAATG
GTAACTTATTTTATAATATTAACAAGATATTTAGCAAGAATAAATAAAGATCTTAAAGTA
CTTGATTTAACAACAAAGTCTCCTATAATATCTTTATTAAATACATCAATTCATGGACTT
AGTACAATAAGATGTTTAGATTTAAGTCATAGATTAAAAAGAGAAATGCGATCAAGTATA
GGAGAAAATTTAAAATCTTATATTTCGTTTCAGGTAATATTTAGAGGAATTCAGATGTAT
TTAGATATCGGTCCAAATATTATGAATGTTGTAAATATTATTGTATTAGTTTTGATTAAG
GATACAATGACTCCAGGGCTTGCAGGAATGAGTATTTCATTAACCATAACAATCATGGGC
TATGTTGGATATTTGTTTAGAATCGGTATTGATACAGACAATAACATGGCTTCACCCCAA
CGTCTTTTTGAATATCAAAAACTAGAACCTGAAGGGGATCATATAAAAGATGGATCATTC
AAAATCTCAAAAGGGAAAATTGAAGTACGTGAACTATATATGAAATATCGTGAAAACTAT
GACTTTGCCCTAAAAGGTTTAAACTTTACAATCCAACCTGGAATGAAAACTGGGATAATC
GGCCGAACAGGTGCTGGTAAATCTTCTATAATGCAAGTTCTTTTCCGTTTAACAAACCCA
CAACAAGGAACTATTTTCATAGATGGTCAAGATTATCTTAAAGCAGGACTTCATGAACTA
AGAAAACAAATGTCTGTAATTCCTCAAACTGCAACACTTTTTATTGCAAGTCTTAAAGAT
AATCTTGATCCATTTCATGAACATTCTGATGATGAAATAAAAAAAGTACTTGGAAAAGTT
AGACTTGGAGGATTATTAGATCATCTTCCTAAAGGACTTGAATCACAAATAAATTCAAAA
GGACTTAGTTTATCAGCTGGACAAAAACAACTTGTATGTTTAGCTAGAGCTATTTTAAGA
AGGAATAAAATTGTAATGATTGATGAAGCAACTGCTAATGTAGATAGTGAAACAGATGAA
TTTATACAAAGTCAATTAATGAAAAGATTTAAGAATAGTACACTTTTAATTGTTGCGCAT
AGACTTAGAACTGTTATAGAGAGTGATTGGATGGTTGTTATGGATGAAGGAAAAACTTTA
CAGGAAGGGCATCCAAGAGATTTGATAAAAGAGCCTGATTCACTTTTGATGAAGATGATT
AAGCATACTGGACAAGAAGAAAGCGAATATTTACTTTCTAAGCTAGTTACTATAGGATAA