Identifiers and Description

Gene Model Identifier

SteCoe_8652

Standard Name

None

Aliases

None

Description

MCM_OB domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007039107.47197233734299e-43MCM2/3/5 family protein; Compo
nent of the MCM complex involv
ed in DNA replication
Oxytricha TrifallaxContig3653.0.g1115.5210822770285325e-42MCM2/3/5 family

WormBaseWBGene000031541.7587922024243116e-25
Saccharomyces CerevisiaeYBL023C1.2995814250075031e-24Protein involved in DNA replic
ation; component of the Mcm2-7
hexameric helicase complex th
at binds chromatin as a part o
f the pre-replicative complex;
relative distribution to the
nucleus increases upon DNA rep
lication stress

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_8652(Protein)
MDSFENWRIFETYLCEKHSTDLDLIKSSESLTSRHTLEIDISELLNYSILFIPMIYNNPY
DLMVKFSLRIKQILQYSDNENLKVDVRMTNVPSNFIRNSLGSIGVADSGKLLSITGTVIL
CGTIKSLAIRKKFKCCLCGTEFELEASISLFNSFEMPNQCPGPKCRNYNFEEVPGSEEWI
DYREVKIYDAFTSAYRGRLPQSLWVILTSEQVGQCTAGDDISITGIIIKRWFPLIKQQFC
ELQLVLLATSLQVCNSKIQRPSLEIVEKGQYSDFELRKAMLTSFAPLIYGYGSIKLGILL
CIIGGIREEVGTLHLRGHSHCLLLGEPGTGKSDILREACKLISRGIYTNAIGASKAGLTL
SAIKEGNDWMLEAGALVLADSGLCALDDLSFLNKEDLTEIYECMENQTISVAKAGMVCTV
NTRTTIIAACRPKKSRFDFGLDLAENANMPAPLLSRFDLIFLLVDMPDSDADYHKSRFIL
KRNTDKKHIFTIGQVQYLLWKATIYKPVFSQVASEILNRYFDLLRKDHRADVTMRQLESL
LRLAQAHARLCQKSEVDSFDAISTILLYESTYRGIGLCDNISFTSLTEFQIAYNQIITRL
GCDGFFIDDSIFK


>SteCoe_8652(CDS)
ATGGATTCTTTTGAGAATTGGCGGATTTTTGAAACCTACCTCTGCGAGAAACACAGTACC
GACCTTGATCTAATAAAATCATCAGAATCTTTAACATCAAGACATACCCTAGAAATAGAT
ATTTCTGAGCTTTTAAACTATTCAATATTATTCATACCTATGATATATAACAATCCATAT
GATCTTATGGTGAAATTTTCTTTAAGAATAAAACAAATTTTACAGTATTCTGATAATGAA
AATTTAAAAGTTGATGTGAGGATGACGAATGTTCCATCAAATTTCATAAGGAATTCTTTA
GGAAGTATTGGTGTTGCTGATAGTGGGAAATTATTAAGTATTACTGGGACAGTGATTTTG
TGTGGGACTATTAAAAGCTTGGCGATTAGGAAAAAATTCAAGTGCTGCTTGTGTGGAACT
GAGTTTGAACTAGAAGCAAGCATAAGTTTATTTAATAGCTTTGAAATGCCAAATCAATGT
CCAGGACCTAAATGCCGCAACTACAACTTTGAAGAAGTCCCTGGAAGTGAGGAATGGATT
GATTATCGTGAGGTAAAAATCTATGATGCCTTTACTAGTGCATATCGTGGTAGACTCCCT
CAATCTTTATGGGTTATCCTTACTAGTGAGCAAGTTGGTCAATGTACAGCTGGTGATGAT
ATTTCTATAACAGGTATAATAATCAAACGTTGGTTTCCTTTAATTAAACAGCAATTCTGT
GAACTGCAACTAGTCCTCCTAGCCACATCTCTCCAAGTCTGTAACTCAAAAATCCAAAGA
CCCTCTTTAGAAATCGTTGAAAAAGGCCAATACTCAGATTTTGAGCTCAGAAAAGCTATG
CTTACCAGTTTTGCCCCTCTAATATATGGTTATGGCAGTATAAAACTAGGAATTCTCCTC
TGTATAATAGGAGGTATCCGAGAAGAAGTAGGTACTTTACATCTTCGTGGACATTCTCAT
TGCCTTTTACTTGGTGAGCCTGGTACTGGTAAATCTGATATTCTTCGTGAAGCTTGTAAA
TTAATATCAAGAGGTATATATACAAATGCTATTGGGGCAAGTAAAGCAGGTTTAACATTA
AGTGCTATAAAAGAAGGAAATGATTGGATGTTAGAAGCTGGTGCTTTAGTATTAGCTGAT
AGTGGTTTATGTGCACTTGATGATTTATCATTTTTAAATAAAGAGGATTTAACAGAAATT
TATGAATGTATGGAAAATCAAACTATTAGTGTTGCTAAAGCTGGAATGGTATGTACAGTT
AATACAAGAACTACTATTATTGCTGCATGTAGACCAAAAAAATCGAGGTTTGATTTTGGT
TTGGATTTAGCTGAGAATGCTAATATGCCAGCACCACTTTTGAGTAGATTTGATTTGATT
TTCCTTCTTGTAGATATGCCGGATTCTGATGCGGATTATCACAAATCTAGATTCATTTTA
AAACGGAATACTGATAAAAAACATATTTTTACTATTGGTCAAGTTCAATATTTGCTGTGG
AAAGCAACGATTTATAAACCTGTTTTTTCACAAGTTGCCTCTGAAATCCTTAACCGGTAT
TTTGACTTGTTACGAAAAGATCATAGAGCAGATGTGACAATGAGACAATTAGAATCGCTT
TTGAGACTTGCTCAAGCACATGCACGTTTATGTCAGAAATCTGAAGTTGACTCTTTTGAT
GCTATAAGCACAATTCTCCTTTATGAATCTACATACAGAGGTATAGGGCTATGTGACAAT
ATATCCTTTACATCATTAACAGAGTTCCAAATCGCTTATAATCAAATCATAACTCGTCTG
GGCTGTGATGGATTTTTTATAGATGACAGCATTTTTAAATAG