Identifiers and Description

Gene Model Identifier

SteCoe_8781

Standard Name

None

Aliases

None

Description

PCI domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig746.1.g142.6102790696677047e-23PCI domain

Tetrahymena ThermophilaTTHERM_003884401.0530617357553812e-20PCI domain containing protein
Saccharomyces CerevisiaeYDR427W1.0530617357553812e-20Non-ATPase regulatory subunit
of the 26S proteasome; similar
to putative proteasomal subun
its in other species; null mut
ant is temperature sensitive a
nd exhibits cell cycle and pro
teasome assembly defects; prot
ein abundance increases in res
ponse to DNA replication stres
s; relocalizes to the cytosol
in response to hypoxia
WormBaseWBGene000044650.00000000000003442477108469977

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_8781(Protein)
MESLSSDIRELYEKRLWHELTERLLLLDSHSISRIWPSISAFREKLNQSKLVLLAIKATE
EQDPDTAKVFLENLQLQDSQASLLLKIAISSQHLRIGSLQEAQVLLEEALKAVDKENDLD
SIIYSHLYGTLSNLYKAKVNPELFYKYSLQYLAYTPQNEVKEPEELAYRLAIAVLIAETV
YNLGELINQPVLKSLENSKNAWLYELLHLCNEGKVREIENMVSGLPDELKTPALLRKVKI
LAMMEYVFTSGKKVLGFEELSQIMNVRENEIEHLMMKAMALGLVKGEIDEVDKIITVNWL
QPRVLDQSRISTLNSRLTEWKKTIKNVLSHLEDQSKELLE


>SteCoe_8781(CDS)
ATGGAAAGTTTGTCCTCAGACATCCGCGAACTATATGAAAAAAGGCTTTGGCACGAGCTG
ACAGAAAGACTTCTTCTTCTCGACAGTCATTCTATCAGTAGGATCTGGCCAAGCATATCA
GCTTTCCGTGAAAAACTCAATCAAAGCAAGCTTGTCCTCCTCGCCATCAAAGCAACAGAG
GAACAAGATCCAGATACAGCTAAAGTCTTCCTTGAAAACCTTCAACTTCAAGACAGCCAA
GCTTCTCTTTTGCTAAAAATTGCTATAAGTTCTCAACATCTTCGTATCGGGTCACTTCAA
GAAGCTCAAGTCTTACTTGAAGAAGCTCTTAAAGCTGTGGATAAAGAAAATGATTTAGAC
TCAATAATATATTCGCATCTATACGGAACTTTATCTAATTTATATAAAGCAAAAGTGAAT
CCTGAACTTTTTTATAAATACTCATTACAGTATTTGGCTTATACCCCACAAAATGAAGTT
AAGGAACCTGAGGAATTAGCTTATAGACTTGCTATTGCTGTGCTTATTGCAGAAACTGTT
TACAATCTTGGTGAGCTTATTAATCAACCGGTACTTAAAAGTTTAGAGAATTCGAAAAAT
GCTTGGCTTTATGAACTATTACATTTATGCAATGAAGGAAAAGTTAGGGAAATTGAAAAT
ATGGTAAGTGGGTTGCCTGATGAACTTAAAACCCCTGCTTTGTTGAGAAAAGTTAAAATT
TTGGCTATGATGGAGTATGTTTTTACTTCAGGGAAAAAAGTTTTAGGATTTGAAGAGTTG
AGTCAGATTATGAATGTTAGGGAAAATGAGATTGAACATTTGATGATGAAAGCTATGGCT
TTGGGACTTGTTAAAGGGGAAATAGATGAGGTTGATAAAATAATTACTGTCAATTGGCTA
CAGCCTAGAGTTCTTGACCAGAGCCGAATTTCGACATTAAATTCAAGACTCACAGAGTGG
AAGAAAACAATCAAAAATGTTCTGAGCCATTTAGAAGATCAATCAAAAGAATTATTAGAA
TAA